Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.71
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.400 1.3e-04
lung adenocarcinoma 1.100 5.4e-12
medulloblastoma, large-cell 1.200 1.5e-04
non-small cell lung cancer 1.204 1.7e-17
osteosarcoma -1.299 5.2e-04

 IMPC Phenotype (1)

Gene RIF (3)

AA Sequence

MAEERPGAWFGFGFCGFGQELGSGRGRQVHSPSPLRAGVDICRVSASWSYTAFVTRGGRLELSGSASGAA      1 - 70
GRCKDAWASEGLLAVLRAGPGPEALLQVWAAESALRGEPLWAQNVVPEAEGEDDPAGEAQAGRLPLLPCA     71 - 140
RAYVSPRAPFYRPLAPELRARQLELGAEHALLLDAAGQVFSWGGGRHGQLGHGTLEAELEPRLLEALQGL    141 - 210
VMAEVAAGGWHSVCVSETGDIYIWGWNESGQLALPTRNLAEDGETVAREATELNEDGSQVKRTGGAEDGA    211 - 280
PAPFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFV    281 - 350
DKQLQVKAVTCGPWNTYVYAVEKGKS                                                351 - 376
//

Text Mined References (10)

PMID Year Title