Property Summary

NCBI Gene PubMed Count 52
PubMed Score 121.01
PubTator Score 149.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.600 5.8e-06
group 3 medulloblastoma 1.800 1.3e-04
atypical teratoid / rhabdoid tumor 1.600 1.4e-06
medulloblastoma, large-cell 2.700 2.3e-05
primitive neuroectodermal tumor 1.200 1.0e-03
Atopic dermatitis 1.100 8.2e-05
non-small cell lung cancer 1.385 4.1e-21
colon cancer 1.600 1.5e-03
lung cancer 1.400 4.1e-04
pediatric high grade glioma 1.300 2.2e-06
lung adenocarcinoma 1.600 1.6e-11
inflammatory breast cancer 1.200 1.3e-03
psoriasis 1.100 1.3e-79

Gene RIF (22)

PMID Text
26823742 RCC1 expression is frequently lost in poorly differentiated gastric cell lines and gastric carcinoma tissues. Loss of RCC1 expression is correlated with tumor differentiation and depth of invasion.
25452301 stress can disrupt the Ran gradients through RCC1-dependent and RCC1-independent mechanisms
25348717 PI3Kbeta regulates the nuclear envelope through upstream regulation of RCC1 and Ran
23536659 RCC1 facilitates a tight binding between the encephalomyocarditis virus leader and cellular Ran GTPase.
22944692 Positional proteomics analysis identifies the cleavage of human regulator of chromosome condensation 1 (RCC1) at amino acid residues 38-39 by the HIV-1 protease
22215983 RCC1 can induce bipolar spindle formation. Remarkably, RCC1 beads oscillate within spindles from pole to pole, a behavior that could be converted to a more typical, stable association by the addition of a kinesin together with RCC1.
20668449 discovery of the first alpha-N-methyltransferase, which we named N-terminal RCC1 methyltransferase (NRMT).
20347844 The authors find that RCC1 uses a conformationally flexible loop region we have termed the switchback loop in addition to its N-terminal tail to bind to the nucleosome.
19060893 Therefore, we propose that RCC1 reads the histone code created by caspase-activated Mst1 to initiate apoptosis by reducing the level of RanGTP in the nucleus.
18762580 The N-terminal tail of RCC1 is essential for association with DNA but inhibits histone binding.
18712773 reduced binding affinity of RCC1 to the mitotic chromosome, which led to a reduction of RanGTP level.
18568422 RCC1 undergoes post-translational phosphorylation
18442486 A review of the function and structure of RCC1 and RCC1 superfamily genes and proteins.
18439570 chromosome 1p36 was established to have linkage for adhd.
17855385 These results show that human RCC1 isoforms have distinct chromatin binding properties, different molecular interactions, and are selectively regulated by phosphorylation, as determined by their different NTRs.
17435751 Propose bimodal attachment mechanism for RCC1 in which the tail promotes stable RCC1 association with chromatin through DNA binding in an alpha-N-methylation-dependent manner.
17251553 HSV-1 replication is blocked in cell line tsBN2 encoding a temperature sensitive RCC1 protein.
16052169 This 30 kb deletion contains the exons coding for the RCC1-like domain of RPGR. It is the first report of a macrodeletion that spans the entire RCC1-like domain of RPGR in X-linked retinitis pigmentosa patients
15014043 phosphorylation of the NLS of RCC1 is required to prevent the binding of importin alpha and beta to RCC1, thereby allowing RCC1 to couple RanGTP production to chromosome binding
14565978 RCC1 release from chromatin in vitro requires a factor(s) distinct from, or in addition to, Ran
12194828 These results indicate that the generation of Ran-GTP in the vicinity of chromosomes by RCC1 is important for the fidelity of mitotic spindle assembly in human cells.
11932251 RanBP3 associates with the Ran-specific guanine nucleotide exchange factor, regulator of chromosome condensation 1 (RCC1).

AA Sequence

MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVV      1 - 70
QAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRV     71 - 140
FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPEL    141 - 210
FANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESC    211 - 280
FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV    281 - 350
ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ    351 - 420
S//

Text Mined References (58)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26823742 2015 Methylation-silencing RCC1 expression is associated with tumorigenesis and depth of invasion in gastric cancer.
25452301 2015 Disruption of the ran system by cysteine oxidation of the nucleotide exchange factor RCC1.
25348717 2015 Phosphoinositide 3-kinase beta protects nuclear envelope integrity by controlling RCC1 localization and Ran activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23536659 2013 Guanine-nucleotide exchange factor RCC1 facilitates a tight binding between the encephalomyocarditis virus leader and cellular Ran GTPase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22215983 2011 Mitotic spindle assembly around RCC1-coated beads in Xenopus egg extracts.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20668449 2010 NRMT is an alpha-N-methyltransferase that methylates RCC1 and retinoblastoma protein.
20347844 2010 RCC1 uses a conformationally diverse loop region to interact with the nucleosome: a model for the RCC1-nucleosome complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19060893 2009 Apoptotic histone modification inhibits nuclear transport by regulating RCC1.
18762580 2008 Regulation of chromatin binding by a conformational switch in the tail of the Ran exchange factor RCC1.
18712773 2008 Perturbation of the chromosomal binding of RCC1, Mad2 and survivin causes spindle assembly defects and mitotic catastrophe.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18617507 2008 Proteomics identification of nuclear Ran GTPase as an inhibitor of human VRK1 and VRK2 (vaccinia-related kinase) activities.
18568422 2009 Ran GTPase guanine nucleotide exchange factor RCC1 is phosphorylated on serine 11 by cdc2 kinase in vitro.
18442486 2008 The RCC1 superfamily: from genes, to function, to disease.
18439570 2008 Linkage to chromosome 1p36 for attention-deficit/hyperactivity disorder traits in school and home settings.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855385 2007 RCC1 isoforms differ in their affinity for chromatin, molecular interactions and regulation by phosphorylation.
17435751 2007 N-terminal alpha-methylation of RCC1 is necessary for stable chromatin association and normal mitosis.
17251553 2007 Blocks to herpes simplex virus type 1 replication in a cell line, tsBN2, encoding a temperature-sensitive RCC1 protein.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16820410 2006 Novel function of beta-arrestin2 in the nucleus of mature spermatozoa.
16052169 2005 Novel deletion spanning RCC1-like domain of RPGR in Japanese X-linked retinitis pigmentosa family.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15014043 2004 Phosphorylation of RCC1 in mitosis is essential for producing a high RanGTP concentration on chromosomes and for spindle assembly in mammalian cells.
14565978 2004 The dynamic association of RCC1 with chromatin is modulated by Ran-dependent nuclear transport.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194828 2002 Targeting of RCC1 to chromosomes is required for proper mitotic spindle assembly in human cells.
12062430 2002 Identification of casein kinase Ialpha interacting protein partners.
11932251 2002 Ran-binding protein 3 links Crm1 to the Ran guanine nucleotide exchange factor.
11375490 2001 Chromatin docking and exchange activity enhancement of RCC1 by histones H2A and H2B.
11336674 2001 Structural basis for guanine nucleotide exchange on Ran by the regulator of chromosome condensation (RCC1).
11310559 2001 Identification of nuclear-import and cell-cycle regulatory proteins that bind to prothymosin alpha.
10875935 2000 The nucleoporin Nup98 is a site for GDP/GTP exchange on ran and termination of karyopherin beta 2-mediated nuclear import.
10811825 2000 Nuclear import of the ran exchange factor, RCC1, is mediated by at least two distinct mechanisms.
10744690 2000 The nuclear import of RCC1 requires a specific nuclear localization sequence receptor, karyopherin alpha3/Qip.
10369786 1999 Model of the ran-RCC1 interaction using biochemical and docking experiments.
10089422 1999 Crystallization and preliminary X-ray analysis of human RCC1, the regulator of chromosome condensation.
9637251 1998 Human RanBP3, a group of nuclear RanGTP binding proteins.
9510255 1998 The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
7983178 1994 Mammalian cells have two functional RCC1 proteins produced by alternative splicing.
7851910 1994 The human CHC1 gene encoding RCC1 (regulator of chromosome condensation) (CHC1) is localized to human chromosome 1p36.1.
7616957 1995 RanBP1, a Ras-like nuclear G protein binding to Ran/TC4, inhibits RCC1 via Ran/TC4.
3678831 1987 Isolation and characterization of the active cDNA of the human cell cycle gene (RCC1) involved in the regulation of onset of chromosome condensation.
2677018 1989 The RCC1 protein, a regulator for the onset of chromosome condensation locates in the nucleus and binds to DNA.
2236072 1990 A 47-kDa human nuclear protein recognized by antikinetochore autoimmune sera is homologous with the protein encoded by RCC1, a gene implicated in onset of chromosome condensation.
1961752 1991 Mitotic regulator protein RCC1 is complexed with a nuclear ras-related polypeptide.
1944575 1991 Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1.
1769659 1991 Complete nucleotide sequence of the human RCC1 gene involved in coupling between DNA replication and mitosis.