Property Summary

NCBI Gene PubMed Count 13
PubMed Score 31.61
PubTator Score 9.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.100 1.2e-05
osteosarcoma -1.044 3.6e-03
ependymoma 1.100 3.9e-05
cystic fibrosis 1.329 2.5e-05
astrocytoma 1.100 2.3e-02
acute quadriplegic myopathy 1.713 8.3e-06
lung cancer -1.500 5.1e-04
sonic hedgehog group medulloblastoma 1.600 8.9e-06
subependymal giant cell astrocytoma 1.599 2.2e-02
spina bifida 1.262 4.4e-02
Breast cancer -1.700 8.5e-18
invasive ductal carcinoma -1.100 2.6e-04
ovarian cancer -2.300 4.8e-07
dermatomyositis 1.200 5.7e-04

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12115502 decreased expression in prostate cancer associated with the difference in frequency of variant isoforms between normal and neoplastic prostate tissues places it in a pivotal role or possibly adjacent to a gene with that role in prostate cancer evolution

AA Sequence

MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVL      1 - 70
GTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGL     71 - 140
VPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGCLQNKVVVTI    141 - 210
ACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYA    211 - 280
WGANSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHF    281 - 350
SCTDDVFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFR    351 - 420
SSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEE    421 - 490
NAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN             491 - 551
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20568903 2010 Expression of RAN, ZHX-2, and CHC1L genes in multiple myeloma patients and in myeloma cell lines treated with HDAC and Dnmts inhibitors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18353163 2008 Low expression of ZHX2, but not RCBTB2 or RAN, is associated with poor outcome in multiple myeloma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14504426 2003 A culture device demonstrates that hydrostatic pressure increases mRNA of RGS5 in neuroblastoma and CHC1-L in lymphocytic cells.
12886522 2003 Extensive analysis of the 13q14 region in human prostate tumors: DNA analysis and quantitative expression of genes lying in the interval of deletion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12115502 2002 CHC1-L, a candidate gene for prostate carcinogenesis at 13q14.2, is frequently affected by loss of heterozygosity and underexpressed in human prostate cancer.
9806834 1998 cDNA cloning, gene characterization and 13q14.3 chromosomal assignment of CHC1-L, a chromosome condensation regulator-like guanine nucleotide exchange factor.