Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.75
PubTator Score 8.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -2.700 8.3e-08
astrocytic glioma -2.500 7.9e-03
group 4 medulloblastoma 2.300 6.1e-04
cystic fibrosis 1.093 1.1e-04
lung cancer 1.300 8.9e-04
Breast cancer 3.000 2.3e-02
pediatric high grade glioma -1.300 2.6e-02
pilocytic astrocytoma -1.300 1.4e-02
posterior fossa group B ependymoma 1.600 6.9e-07
sarcoidosis -1.300 8.6e-06
subependymal giant cell astrocytoma -3.596 1.1e-02
lung carcinoma 1.500 5.8e-19
progressive supranuclear palsy -1.100 3.7e-02
invasive ductal carcinoma 1.200 1.4e-02
acute myeloid leukemia 1.500 3.7e-02
ovarian cancer 1.300 2.9e-03

Synonym

Accession Q9UKA8 A4GU14 A4LA69 E3VWE2 E5L4P0 E5L4P7 E7ENV1 E7EWD8 G1FI66 G1FLF0 Q5ECL3 Q5TGC6 Q9NUC8 Q9UKA7
Symbols RCN3
MCIP3
hRCN3
DSCR1L2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25916653 The tumor suppressor effect of RCAN3 in breast cancer depends on the interaction with calcineurin.
21961037 Studies indicate that RCAN3 is composed of a multigene system that includes at least 21 alternative spliced isoforms.
21042787 Data shows RCAN3 inhibits HUVEC proliferation both basally and under VEGF or phorbol 12-myristate 13-acetate-stimulated conditions, however it does not modulate gene expression of the chosen inflammatory genes.
19819266 our data have elucidated the molecular and cellular mechanism whereby PGF(2alpha) regulates CXCL8 expression via the FP receptor in endometrial adenocarcinomas and have highlighted RCAN1-4 as a negative regulator of CXCL8 expression
19074885 Observational study of gene-disease association. (HuGE Navigator)
18022329 The interaction between TNNI3 and the new R variants of RCAN3, RCAN3-2,3,5 and RCAN3-2,4,5, is reported.
17270291 human RCAN3, encoded by the RCAN3 (also known as DSCR1L2) gene, interacts physically and functionally with calcineurin
16516408 The yeast cotransformation and GST fusion protein assay demonstrated the interaction between this new DSCR1L2 variant and the human cardiac troponin I.

AA Sequence

MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEA      1 - 70
LFTIYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQ     71 - 140
PVKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEE    141 - 210
TKNPKQKIAQTRRPDPPTAALNEPQTFDCAL                                           211 - 241
//

Text Mined References (15)

PMID Year Title
25916653 2015 A novel role for an RCAN3-derived peptide as a tumor suppressor in breast cancer.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
21961037 2011 Complexity of bidirectional transcription and alternative splicing at human RCAN3 locus.
21042787 2010 Human RCAN3 gene expression and cell growth in endothelial cells.
19819266 2009 Prostaglandin F(2alpha)-F-prostanoid receptor regulates CXCL8 expression in endometrial adenocarcinoma cells via the calcium-calcineurin-NFAT pathway.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18022329 2008 Identification and analysis of human RCAN3 (DSCR1L2) mRNA and protein isoforms.
17270291 2007 RCAN3, a novel calcineurin inhibitor that down-regulates NFAT-dependent cytokine gene expression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16516408 2006 Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10756093 2000 A new gene family including DSCR1 (Down Syndrome Candidate Region 1) and ZAKI-4: characterization from yeast to human and identification of DSCR1-like 2, a novel human member (DSCR1L2).