Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.75
PubTator Score 8.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia 1.500 3.7e-02
astrocytic glioma -2.500 7.9e-03
Astrocytoma, Pilocytic -1.300 1.4e-02
Breast cancer 3.000 2.3e-02
cystic fibrosis 1.093 1.1e-04
group 4 medulloblastoma 2.300 6.1e-04
invasive ductal carcinoma 1.200 1.4e-02
lung cancer 1.300 8.9e-04
lung carcinoma 1.500 5.8e-19
malignant mesothelioma -2.700 8.3e-08
ovarian cancer 1.300 2.9e-03
pediatric high grade glioma -1.300 2.6e-02
posterior fossa group A ependymoma 1.200 3.3e-08
progressive supranuclear palsy -1.100 3.7e-02
sarcoidosis -1.300 8.6e-06
subependymal giant cell astrocytoma -3.596 1.1e-02

Gene RIF (8)

AA Sequence

MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEA      1 - 70
LFTIYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQ     71 - 140
PVKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEE    141 - 210
TKNPKQKIAQTRRPDPPTAALNEPQTFDCAL                                           211 - 241
//

Text Mined References (15)

PMID Year Title