Property Summary

NCBI Gene PubMed Count 13
PubMed Score 103.77
PubTator Score 320.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -5.200 1.4e-09
astrocytic glioma -3.100 5.5e-03
ependymoma -4.800 1.0e-03
oligodendroglioma -2.600 1.6e-02
psoriasis -1.800 3.2e-07
glioblastoma -3.000 1.7e-06
sonic hedgehog group medulloblastoma -3.700 1.7e-09
cystic fibrosis -1.031 3.3e-04
atypical teratoid / rhabdoid tumor -4.600 1.6e-09
medulloblastoma, large-cell -4.100 7.0e-05
primitive neuroectodermal tumor -2.600 6.8e-03
non-small cell lung cancer -1.588 1.2e-13
intraductal papillary-mucinous adenoma (... -3.100 1.0e-04
intraductal papillary-mucinous carcinoma... -3.000 1.5e-03
intraductal papillary-mucinous neoplasm ... -3.200 1.5e-03
colon cancer -3.100 5.5e-03
lung cancer -1.900 1.1e-03
adult high grade glioma -3.200 3.6e-05
pilocytic astrocytoma -2.400 6.7e-07
severe Alzheimer's disease -1.158 3.5e-02
lung carcinoma 1.900 7.4e-16
Pick disease -1.600 7.0e-03
invasive ductal carcinoma -2.200 3.1e-03
pituitary cancer 1.900 3.6e-08
head and neck cancer -1.700 1.6e-02

Synonym

Accession Q14206 A6ND07 B3KR46 Q5VWF7 Q5VWF8 Q8N116
Symbols CSP2
RCN2
MCIP2
ZAKI4
ZAKI-4
DSCR1L1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19819266 our data have elucidated the molecular and cellular mechanism whereby PGF(2alpha) regulates CXCL8 expression via the FP receptor in endometrial adenocarcinomas and have highlighted RCAN1-4 as a negative regulator of CXCL8 expression
17610901 DSCR1-L1 is constitutively expressed in endothelial cells and acts similar to DSCR1 in inhibiting calcineurin activity and restraining VEGF-mediated angiogenesis.
12102656 the expression of ZAKI-4 isoforms is subjected to distinct hormonal as well as tissue-specific regulation, constituting a complex signalling network through inhibition of calcineurin.

AA Sequence

MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIE      1 - 70
LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVA     71 - 140
KLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSN                 141 - 197
//

Text Mined References (14)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19819266 2009 Prostaglandin F(2alpha)-F-prostanoid receptor regulates CXCL8 expression in endometrial adenocarcinoma cells via the calcium-calcineurin-NFAT pathway.
17610901 2007 Down syndrome candidate region 1-like 1 (DSCR1-L1) mimics the inhibitory effects of DSCR1 on calcineurin signaling in endothelial cells and inhibits angiogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12102656 2002 Novel human ZAKI-4 isoforms: hormonal and tissue-specific regulation and function as calcineurin inhibitors.
10861295 2000 DSCR1, overexpressed in Down syndrome, is an inhibitor of calcineurin-mediated signaling pathways.
10756093 2000 A new gene family including DSCR1 (Down Syndrome Candidate Region 1) and ZAKI-4: characterization from yeast to human and identification of DSCR1-like 2, a novel human member (DSCR1L2).
10722714 2000 A protein encoded within the Down syndrome critical region is enriched in striated muscles and inhibits calcineurin signaling.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8662924 1996 Molecular cloning of a novel thyroid hormone-responsive gene, ZAKI-4, in human skin fibroblasts.