Property Summary

NCBI Gene PubMed Count 14
PubMed Score 114.18
PubTator Score 320.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -3.200 3.6e-05
astrocytic glioma -3.100 5.5e-03
Astrocytoma, Pilocytic -2.400 9.1e-07
atypical teratoid / rhabdoid tumor -4.600 1.6e-09
colon cancer -3.100 5.5e-03
cystic fibrosis -1.031 3.3e-04
ependymoma -4.800 1.0e-03
glioblastoma -3.000 1.7e-06
group 3 medulloblastoma -3.100 1.0e-05
head and neck cancer -1.700 1.6e-02
intraductal papillary-mucinous adenoma (... -3.100 1.0e-04
intraductal papillary-mucinous carcinoma... -3.000 1.5e-03
intraductal papillary-mucinous neoplasm ... -3.200 1.5e-03
invasive ductal carcinoma -2.200 3.1e-03
lung cancer -1.900 1.1e-03
lung carcinoma 1.900 7.4e-16
malignant mesothelioma -5.200 1.4e-09
medulloblastoma, large-cell -4.100 7.0e-05
non-small cell lung cancer -1.588 1.2e-13
oligodendroglioma -2.600 1.6e-02
Pick disease -1.600 7.0e-03
pituitary cancer 1.900 3.6e-08
primitive neuroectodermal tumor -2.600 6.8e-03
psoriasis -1.800 3.2e-07
severe Alzheimer's disease -1.158 3.5e-02

Gene RIF (5)

AA Sequence

MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIE      1 - 70
LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVA     71 - 140
KLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSN                 141 - 197
//

Text Mined References (15)

PMID Year Title