Property Summary

NCBI Gene PubMed Count 101
PubMed Score 254.41
PubTator Score 173.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Breast cancer -2.900 1.5e-17
breast carcinoma -1.500 2.0e-25
cystic fibrosis -1.171 1.7e-03
dermatomyositis 1.100 1.2e-02
glioblastoma 2.400 8.3e-03
interstitial cystitis 1.700 6.3e-05
intraductal papillary-mucinous adenoma (... -1.600 3.5e-03
intraductal papillary-mucinous carcinoma... -1.900 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.1e-02
invasive ductal carcinoma -1.135 1.6e-02
juvenile dermatomyositis 1.028 3.3e-06
lung adenocarcinoma -1.100 1.4e-05
lung cancer -3.900 4.1e-05
malignant mesothelioma -1.400 1.8e-06
medulloblastoma -1.100 1.4e-04
medulloblastoma, large-cell -2.400 1.5e-07
non-small cell lung cancer -1.027 2.3e-08
ovarian cancer 1.400 1.8e-08
pancreatic ductal adenocarcinoma liver m... -1.841 5.5e-04
pituitary cancer -1.700 1.0e-05
psoriasis -2.100 1.7e-05
tuberculosis 1.100 1.8e-04

 GWAS Trait (2)

Gene RIF (84)

AA Sequence

MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA      1 - 70
CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF     71 - 140
AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS    141 - 210
VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS                                211 - 252
//

Text Mined References (101)

PMID Year Title