Property Summary

NCBI Gene PubMed Count 100
PubMed Score 67.18
PubTator Score 96.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Stevens-Johnson syndrome 91
Disease Target Count P-value
ovarian cancer 8491 3.6e-05
astrocytoma 1493 2.7e-03
acute myeloid leukemia 785 3.1e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.533 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.100 2.7e-03
acute myeloid leukemia -1.300 3.1e-02
ovarian cancer 2.100 3.6e-05

Gene RIF (45)

PMID Text
26742010 ROC1 has an important role in the malignant progression of bladder transitional cell carcinoma via the mTOR/DEPTOR pathway.
26632597 Nedd8(Q40E) cannot induce the same structural effect on Cul1-Rbx1 as wild-type Nedd8.
26540345 Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells.
25981045 HIV-1 complexes with RBX1 (RBX2)
25918018 This work sheds new light on the roles of NEDD8 lysines on neddylation cascades and provides a dominant negative mutant for the study of neddylation and its biological functions.
25912140 These findings indicate that Rbx1 and Rbx2 can both activate Cul5-Vif E3 ligase in vitro, but they may undergo a more delicate selection mechanism in vivo.
25912140 HIV-1 complexes with RBX1 (RBX2)
25423367 eEF1A1 may mediate SAMHD1 turnover by targeting it to the proteosome for degradation through association with Cullin4A and Rbx1.
25412959 upregulation of miR-194 can inhibit proliferation, migration, and invasion of GC cells, possibly by targeting RBX1. Aberrant expression of miR-194 and RBX1 is correlated to GC patient survival time.
25114896 Studied the DNA-level mechanisms affecting KEAP1/CUL3/RBX1 E3-ubiquitin ligase complex as a regulator of NRF2 levels in ovarian cancer.
24989250 CUL4A-DDB1-Rbx1 E3 ligase controls the quality of the PTS2 receptor Pex7p.
24608665 data suggest a new paradigm for Hsp90-modulated assembly of a Cul3/DBC2 E3 ubiquitin ligase complex that may extend to other E3 ligase complexes.
24596130 RBX1 E3 ubiquitin protein expression responsible with multiple genetic mechanism in the development of head and neck cancer.
24292229 RBX1 expression level was associated with the proliferation of gastric cancer.
23609182 Overexpression of RBX1 protein contributes to tumor progression and poor prognosis of non-muscle-invasive bladder cancer (NMIBC).
22936669 A genome-wide association study on a southern European population identified a new Crohn's disease susceptibility locus at RBX1-EP300.
22935614 ROC1 knockdown significantly inhibited the growth of liver cancer cells by sequentially and independently inducing autophagy and p21-dependent cell senescence.
22822056 a model by which N-terminal cleavage of RBX1 impairs its activity and promotes susceptibility to ER stress induction.
22748924 Structural and biochemical analyses reveal that GLMN adopts a HEAT-like repeat fold that tightly binds the E2-interacting surface of RBX1, inhibiting CRL-mediated chain formation by the E2 CDC34.
22553175 Numb regulates glioma stem cell fate and growth by altering epidermal growth factor receptor and Skp1-Cullin-F-box ubiquitin ligase activity
22448038 the early or pre-induction nuclear export of INrf2 in response to antioxidants is controlled by tyrosine phosphorylation, whereas the nuclear export of Cul3 and Rbx1 is controlled by INrf2, allowing normal activation or repression of Nrf2
22405651 Glomulin binds Rbx1 and regulates cullin-1 RING ligase-mediated turnover of Fbw7.
21765416 A new conformation of RBX1 involved in the e2-to-substrate ubiquitin-like protein transfer is discussed.
21300445 ROC1 expression is negatively correlated with cyclin D1 expression, demonstrating its importance in the degradation of cyclin D1 in melanomas.
21130766 Data show that CRN7 interacted with Cullin1 and Roc1 to form a novel SCF-like E3 complex.
21115485 in human cancer cells, RBX1 silencing causes the accumulation of DNA replication licensing proteins CDT1 and ORC1, leading to DNA double-strand breaks, DDR, G(2) arrest, and, eventually, aneuploidy
20452971 Nrf2 regulates Cul3-Rbx1 by controlling regulation of expression and induction of Cul3-Rbx1
20389280 KLHL20-Cul3-ROC1 is an E3 ligase for DAPK ubiquitination
20174454 HIV-1 complexes with RBX1 (RBX2)
19723642 The data suggest that RBX1 could potentially be developed into biomarkers of resistance to acyl sulfonamide-based cancer drugs. This will require clinical validation in a series of patients treated with R3200.
19557001 Data show that REDD1 is subject to ubiquitin-mediated degradation mediated by the CUL4A-DDB1-ROC1-beta-TRCP E3 ligase complex and through the activity of glycogen synthase kinase 3beta.
19509229 ROC1 silencing triggers multiple death and growth arrest pathways to effectively suppress tumor cell growth, suggesting that ROC1 may serve as a potential anticancer target
18826954 SCCRO recruits Ubc12 approximately NEDD8 to the CAND1-Cul1-ROC1 complex but that this is not sufficient to dissociate or overcome the inhibitory effects of CAND1 on cullin neddylation
18789977 HIV-1 complexes with RBX1 (RBX2)
18723677 CUL1 ECTD (extreme C-terminal domain; spanning the C-terminal 50 amino acids), did not contribute to CUL1's stable association with ROC1.
18381890 Results indicate that FBW5-DDB1-CUL4-ROC1 is an E3 ubiquitin ligase regulating TSC2 protein stability and TSC complex turnover.
18332868 VprBP depletion abolished the in vivo interaction of Merlin and Roc1-Cullin4A-DDB1, which resulted in Merlin stabilization and inhibited ERK and Rac activation
17217622 ROC1 protein binds to the proinactive form of pro-caspase 3 and shortens the half life of the enzyme.
16678110 This study uncovers CUL4-DDB-ROC1 as a histone ubiquitin ligase and demonstrate that histone H3 and H4 ubiquitylation participates in the cellular response to DNA damage.
16123585 the SCF complex (Skp1/Cul1/F-box protein/Roc1) intervenes in the surveillance of Cdh1 cellular abundance in S-phase
15601839 Keap1 negatively regulates Nrf2 function in part by targeting Nrf2 for ubiquitination by the CUL3-ROC1 ligase and subsequent degradation by the proteasome
14739464 DET1 promotes ubiquitination and degradation of c-Jun by assembling a multisubunit ubiquitin ligase containing DNA Damage Binding Protein-1 (DDB1), cullin 4A (CUL4A), Regulator of Cullins-1 (ROC1), and constitutively photomorphogenic-1
14564014 findings report that HIV-1 Vif interacts with cellular proteins Cul5, elongins B and C, and Rbx1 to form an Skp1-cullin-F-box (SCF)-like complex
14564014 HIV-1 complexes with RBX1 (RBX2)
11961546 crystal structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF complex

AA Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV      1 - 70
AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH                                     71 - 108
//

Text Mined References (115)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
26742010 2016 Regulator of cullins-1 expression knockdown suppresses the malignant progression of muscle-invasive transitional cell carcinoma by regulating mTOR/DEPTOR pathway.
26632597 2015 Gln40 deamidation blocks structural reconfiguration and activation of SCF ubiquitin ligase complex by Nedd8.
26540345 2015 Cancer-testis antigen MAGE-C2 binds Rbx1 and inhibits ubiquitin ligase-mediated turnover of cyclin E.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25918018 2015 A lysine-to-arginine mutation on NEDD8 markedly reduces the activity of cullin RING E3 ligase through the impairment of neddylation cascades.
25912140 2015 Both Rbx1 and Rbx2 exhibit a functional role in the HIV-1 Vif-Cullin5 E3 ligase complex in vitro.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
25423367 2015 The eukaryotic elongation factor eEF1A1 interacts with SAMHD1.
25412959 2015 miR-194 targets RBX1 gene to modulate proliferation and migration of gastric cancer cells.
25349211 2014 SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).
25114896 2014 Unique pattern of component gene disruption in the NRF2 inhibitor KEAP1/CUL3/RBX1 E3-ubiquitin ligase complex in serous ovarian cancer.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24989250 2014 CUL4A-DDB1-Rbx1 E3 ligase controls the quality of the PTS2 receptor Pex7p.
24949976 2014 Structure of a RING E3 trapped in action reveals ligation mechanism for the ubiquitin-like protein NEDD8.
24793696 2014 CUL9 mediates the functions of the 3M complex and ubiquitylates survivin to maintain genome integrity.
24608665 2014 Hsp90-dependent assembly of the DBC2/RhoBTB2-Cullin3 E3-ligase complex.
24596130 2015 Disruption of KEAP1/CUL3/RBX1 E3-ubiquitin ligase complex components by multiple genetic mechanisms: Association with poor prognosis in head and neck cancer.
24292229 2014 Prognostic impact of RING box protein-1 (RBX1) expression in gastric cancer.
23609182 2013 Overexpression of RING box protein-1 (RBX1) associated with poor prognosis of non-muscle-invasive bladder transitional cell carcinoma.
23274085 2013 Sestrins activate Nrf2 by promoting p62-dependent autophagic degradation of Keap1 and prevent oxidative liver damage.
23263282 2013 SCFFbxo9 and CK2 direct the cellular response to growth factor withdrawal via Tel2/Tti1 degradation and promote survival in multiple myeloma.
23238014 2012 CRL4B catalyzes H2AK119 monoubiquitination and coordinates with PRC2 to promote tumorigenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22936669 2013 A genome-wide association study on a southern European population identifies a new Crohn's disease susceptibility locus at RBX1-EP300.
22935614 2013 Induction of autophagy and senescence by knockdown of ROC1 E3 ubiquitin ligase to suppress the growth of liver cancer cells.
22822056 2012 Endoplasmic reticulum stress induces a caspase-dependent N-terminal cleavage of RBX1 protein in B cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22748924 2012 Structure of a glomulin-RBX1-CUL1 complex: inhibition of a RING E3 ligase through masking of its E2-binding surface.
22660580 2012 F-box protein FBXL19-mediated ubiquitination and degradation of the receptor for IL-33 limits pulmonary inflammation.
22553175 2012 Numb regulates glioma stem cell fate and growth by altering epidermal growth factor receptor and Skp1-Cullin-F-box ubiquitin ligase activity.
22448038 2012 Antioxidant-induced INrf2 (Keap1) tyrosine 85 phosphorylation controls the nuclear export and degradation of the INrf2-Cul3-Rbx1 complex to allow normal Nrf2 activation and repression.
22405651 2012 The glomuvenous malformation protein Glomulin binds Rbx1 and regulates cullin RING ligase-mediated turnover of Fbw7.
22358839 2012 Ubiquitin-dependent regulation of COPII coat size and function.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21765416 2011 A RING E3-substrate complex poised for ubiquitin-like protein transfer: structural insights into cullin-RING ligases.
21572392 2011 SCFFBXL¹? regulates BMP signalling by directing the degradation of HECT-type ubiquitin ligase Smurf1.
21300445 2011 Role of ROC1 protein in the control of cyclin D1 protein expression in skin melanomas.
21269460 2011 Initial characterization of the human central proteome.
21130766 2011 Coronin7 forms a novel E3 ubiquitin ligase complex to promote the degradation of the anti-proliferative protein Tob.
21115485 2011 RBX1 (RING box protein 1) E3 ubiquitin ligase is required for genomic integrity by modulating DNA replication licensing proteins.
20596027 2010 SCF(Cyclin F) controls centrosome homeostasis and mitotic fidelity through CP110 degradation.
20452971 2010 An autoregulatory loop between Nrf2 and Cul3-Rbx1 controls their cellular abundance.
20389280 2010 The Cullin 3 substrate adaptor KLHL20 mediates DAPK ubiquitination to control interferon responses.
20223979 2010 Identification of a primary target of thalidomide teratogenicity.
20129063 2010 CRL4(Cdt2) E3 ubiquitin ligase monoubiquitinates PCNA to promote translesion DNA synthesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19723642 2009 Candidate biomarkers of response to an experimental cancer drug identified through a large-scale RNA interference genetic screen.
19679664 2009 Adenovirus E1A inhibits SCF(Fbw7) ubiquitin ligase.
19557001 2009 REDD1, an inhibitor of mTOR signalling, is regulated by the CUL4A-DDB1 ubiquitin ligase.
19509229 2009 ROC1/RBX1 E3 ubiquitin ligase silencing suppresses tumor cell growth via sequential induction of G2-M arrest, apoptosis, and senescence.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19327355 2009 Requirement for microtubule integrity in the SOCS1-mediated intracellular dynamics of HIV-1 Gag.
19250909 2009 E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.
19112177 2009 Histidine triad nucleotide-binding protein 1 up-regulates cellular levels of p27KIP1 by targeting ScfSKP2 ubiquitin ligase and Src.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18826954 2008 SCCRO (DCUN1D1) is an essential component of the E3 complex for neddylation.
18809579 2008 PML activates transcription by protecting HIPK2 and p300 from SCFFbx3-mediated degradation.
18805092 2008 Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
18794347 2008 PCNA-dependent regulation of p21 ubiquitylation and degradation via the CRL4Cdt2 ubiquitin ligase complex.
18723677 2008 Autoinhibitory regulation of SCF-mediated ubiquitination by human cullin 1's C-terminal tail.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18498745 2008 The CUL7 E3 ubiquitin ligase targets insulin receptor substrate 1 for ubiquitin-dependent degradation.
18397884 2008 Regulation of TIP60 by ATF2 modulates ATM activation.
18381890 2008 WD40 protein FBW5 promotes ubiquitination of tumor suppressor TSC2 by DDB1-CUL4-ROC1 ligase.
18332868 2008 VprBP targets Merlin to the Roc1-Cul4A-DDB1 E3 ligase complex for degradation.
18239684 2008 Phosphorylation of Skp2 regulated by CDK2 and Cdc14B protects it from degradation by APC(Cdh1) in G1 phase.
17636018 2007 ASB4 is a hydroxylation substrate of FIH and promotes vascular differentiation via an oxygen-dependent mechanism.
17543862 2007 A Cul3-based E3 ligase removes Aurora B from mitotic chromosomes, regulating mitotic progression and completion of cytokinesis in human cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17217622 2006 SAG/ROC-SCF beta-TrCP E3 ubiquitin ligase promotes pro-caspase-3 degradation as a mechanism of apoptosis protection.
17183367 2007 COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.
17085480 2006 DTL/CDT2 is essential for both CDT1 regulation and the early G2/M checkpoint.
17028207 2006 Identification and characterization of components of a putative petunia S-locus F-box-containing E3 ligase complex involved in S-RNase-based self-incompatibility.
16751180 2006 CSA-dependent degradation of CSB by the ubiquitin-proteasome pathway establishes a link between complementation factors of the Cockayne syndrome.
16678110 2006 Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.
16503656 2006 Analysis of Nedd8-associated polypeptides: a model for deciphering the pathway for ubiquitin-like modifications.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16123585 2005 Involvement of the SCF complex in the control of Cdh1 degradation in S-phase.
15983046 2005 Ubiquitination of Keap1, a BTB-Kelch substrate adaptor protein for Cul3, targets Keap1 for degradation by a proteasome-independent pathway.
15781449 2005 Ubiquitination of APOBEC3G by an HIV-1 Vif-Cullin5-Elongin B-Elongin C complex is essential for Vif function.
15601839 2005 BTB protein Keap1 targets antioxidant transcription factor Nrf2 for ubiquitination by the Cullin 3-Roc1 ligase.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15103331 2004 Phosphorylation-dependent degradation of c-Myc is mediated by the F-box protein Fbw7.
14960280 2004 Ozz-E3, a muscle-specific ubiquitin ligase, regulates beta-catenin degradation during myogenesis.
14739464 2004 Human De-etiolated-1 regulates c-Jun by assembling a CUL4A ubiquitin ligase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12609982 2003 TIP120A associates with cullins and modulates ubiquitin ligase activity.
12504026 2002 CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.
12481031 2002 CUL7: A DOC domain-containing cullin selectively binds Skp1.Fbx29 to form an SCF-like complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149480 2002 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase.
12140560 2002 E3 ubiquitin ligase that recognizes sugar chains.
11961546 2002 Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
11956208 2002 The novel human DNA helicase hFBH1 is an F-box protein.
11717410 2001 Atrogin-1, a muscle-specific F-box protein highly expressed during muscle atrophy.
11675391 2002 The Nedd8-conjugated ROC1-CUL1 core ubiquitin ligase utilizes Nedd8 charged surface residues for efficient polyubiquitin chain assembly catalyzed by Cdc34.
11384984 2001 Muf1, a novel Elongin BC-interacting leucine-rich repeat protein that can assemble with Cul5 and Rbx1 to reconstitute a ubiquitin ligase.
11359933 2001 Ligand-dependent degradation of Smad3 by a ubiquitin ligase complex of ROC1 and associated proteins.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
11311237 2001 In vitro ubiquitination of cyclin D1 by ROC1-CUL1 and ROC1-CUL3.
11027288 2000 The CUL1 C-terminal sequence and ROC1 are required for efficient nuclear accumulation, NEDD8 modification, and ubiquitin ligase activity of CUL1.
10713156 2000 Nedd8 modification of cul-1 activates SCF(beta(TrCP))-dependent ubiquitination of IkappaBalpha.
10643962 1999 Genomic organization and expression of the ubiquitin-proteasome complex-associated protein Rbx1/ROC1/Hrt1.
10591208 1999 The DNA sequence of human chromosome 22.
10579999 1999 The Rbx1 subunit of SCF and VHL E3 ubiquitin ligase activates Rub1 modification of cullins Cdc53 and Cul2.
10531037 1999 A family of mammalian F-box proteins.
10230407 1999 ROC1, a homolog of APC11, represents a family of cullin partners with an associated ubiquitin ligase activity.
10230406 1999 Recruitment of a ROC1-CUL1 ubiquitin ligase by Skp1 and HOS to catalyze the ubiquitination of I kappa B alpha.
10213692 1999 Reconstitution of G1 cyclin ubiquitination with complexes containing SCFGrr1 and Rbx1.
10213691 1999 Rbx1, a component of the VHL tumor suppressor complex and SCF ubiquitin ligase.