Property Summary

NCBI Gene PubMed Count 104
PubMed Score 72.08
PubTator Score 96.74

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Stevens-Johnson syndrome 92 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.1e-04
astrocytoma 1146 2.7e-03
acute myeloid leukemia 783 3.1e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.614 1.8
Cockayne syndrome 60 3.054 1.5


  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.300 3.1e-02
astrocytoma -1.100 2.7e-03
ovarian cancer -1.100 2.1e-04

Protein-protein Interaction (9)

PDB (11)

Gene RIF (47)

AA Sequence

AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH                                     71 - 108

Text Mined References (119)

PMID Year Title