Property Summary

NCBI Gene PubMed Count 18
PubMed Score 113.99
PubTator Score 24.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
urothelial carcinoma -1.100 6.3e-05
malignant mesothelioma -3.800 6.1e-08
psoriasis -1.800 1.4e-03
glioblastoma 1.500 7.1e-03
atypical teratoid / rhabdoid tumor 1.300 2.3e-02
primitive neuroectodermal tumor 1.200 1.0e-02
adrenocortical carcinoma -1.147 1.2e-02
non-small cell lung cancer -1.309 1.7e-16
intraductal papillary-mucinous adenoma (... -2.000 5.4e-04
intraductal papillary-mucinous carcinoma... -1.900 1.4e-02
colon cancer -2.300 5.9e-04
lung cancer -3.500 4.5e-06
active Crohn's disease 2.474 1.7e-04
active ulcerative colitis 4.375 6.4e-05
group 4 medulloblastoma -1.500 5.1e-03
posterior fossa group A ependymoma 1.100 5.6e-09
non primary Sjogren syndrome sicca 1.300 2.7e-02
subependymal giant cell astrocytoma 2.945 1.6e-02
invasive ductal carcinoma -1.309 6.4e-04
lung carcinoma -1.800 4.4e-19
spina bifida -2.475 3.4e-02
Pick disease 1.200 1.3e-02
Breast cancer -1.500 1.9e-27
ductal carcinoma in situ -1.300 2.7e-03
ovarian cancer -3.300 1.5e-08
pituitary cancer -1.900 4.2e-07
dermatomyositis 1.200 3.3e-02

Gene RIF (2)

PMID Text
25281386 RBPMS1 is a critical repressor of AP-1 signaling and RBPMS1 activation may be a useful strategy for cancer treatment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDS      1 - 70
RSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPAL     71 - 140
YPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC                  141 - 196
//

Text Mined References (20)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
26347403 2016 Structural basis underlying CAC RNA recognition by the RRM domain of dimeric RNA-binding protein RBPMS.
25416956 2014 A proteome-scale map of the human interactome network.
25281386 2015 The RNA-binding protein RBPMS1 represses AP-1 signaling and regulates breast cancer cell proliferation and migration.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22174390 2012 Heritability of submaximal exercise heart rate response to exercise training is accounted for by nine SNPs.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17099224 2006 Potentiation of Smad-mediated transcriptional activation by the RNA-binding protein RBPMS.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8855282 1996 A unique human gene that spans over 230 kb in the human chromosome 8p11-12 and codes multiple family proteins sharing RNA-binding motifs.