Property Summary

NCBI Gene PubMed Count 6
PubMed Score 33.09
PubTator Score 55.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRCLQQQCEQTVR      1 - 70
ILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTVCGYMGLDSASGSATETQKLN     71 - 140
FEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRELGTFHSRLIKVISKPSQKKQSLKNTDLCIS    141 - 210
SGSKVSLFNRLRSQTVSTRYLSVEDGAFVASARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCT    211 - 280
VTGITLPPMIIRKVAKQCALLDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANR    281 - 350
ALLNDSSCWTIIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV    351 - 420
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPE    421 - 490
PATDADALLESIHQEFTRTNFHLFIQT                                               491 - 517
//

Text Mined References (6)

PMID Year Title