Property Summary

NCBI Gene PubMed Count 6
PubMed Score 19.89
PubTator Score 55.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UBG7 O95723 Q5QPU9 Q5QPV0 Q9ULV9
Symbols RBPL
SUHL
RBPSUHL

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
16354684 P48 interacts with the RBP-L and RBP-J subunits primarily through two short conserved tryptophan-containing motifs, similar to the motif of the Notch intracellular domain (NotchIC) that interacts with RBP-J.
9111338 In mouse, there is cooperative transcriptional activity of RBP-L with EBNA-2.

AA Sequence

MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRCLQQQCEQTVR      1 - 70
ILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTVCGYMGLDSASGSATETQKLN     71 - 140
FEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRELGTFHSRLIKVISKPSQKKQSLKNTDLCIS    141 - 210
SGSKVSLFNRLRSQTVSTRYLSVEDGAFVASARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCT    211 - 280
VTGITLPPMIIRKVAKQCALLDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANR    281 - 350
ALLNDSSCWTIIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV    351 - 420
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPE    421 - 490
PATDADALLESIHQEFTRTNFHLFIQT                                               491 - 517
//

Text Mined References (6)

PMID Year Title
16354684 2006 PTF1 is an organ-specific and Notch-independent basic helix-loop-helix complex containing the mammalian Suppressor of Hairless (RBP-J) or its paralogue, RBP-L.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9929984 1999 Chromosomal mapping of two RBP-J-related genes: Kyo-T and RBP-L.
9111338 1997 RBP-L, a transcription factor related to RBP-Jkappa.