Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.10
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.300 2.8e-03
interstitial cystitis 1.600 3.1e-04
pancreatic ductal adenocarcinoma liver m... -1.513 9.7e-03

Gene RIF (1)

AA Sequence

MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVE      1 - 70
FEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR          71 - 135
//

Text Mined References (11)

PMID Year Title