Property Summary

NCBI Gene PubMed Count 27
PubMed Score 120.91
PubTator Score 62.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.3e-13
active ulcerative colitis 764 3.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
active ulcerative colitis -1.045 3.1e-02
psoriasis -1.700 5.3e-13

PDB (27)

Gene RIF (13)

AA Sequence

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE      1 - 70
FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK           71 - 134
//

Text Mined References (28)

PMID Year Title