Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.74
PubTator Score 11.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Pick disease 1894 1.8e-05
ovarian cancer 8520 1.4e-03
Rheumatoid arthritis 1191 1.5e-02

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.300 1.4e-03
Pick disease 1.200 1.8e-05
Rheumatoid arthritis 1.600 1.5e-02

AA Sequence

MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMN      1 - 70
GKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTRGPPSRGGHMDDGGYSMNFNM     71 - 140
SSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPR    141 - 210
DDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGS    211 - 280
YRDSYESYGNSRSAPLTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPP    281 - 350
SVERGYPSSRDSYSSSSRGAPRGAGPGGSRSDRGGGRSRY                                  351 - 390
//

Text Mined References (15)

PMID Year Title