Property Summary

NCBI Gene PubMed Count 50
PubMed Score 32.85
PubTator Score 22.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 2.000 2.6e-02
oligodendroglioma 1.800 4.1e-02
glioblastoma 1.800 5.2e-08
osteosarcoma 4.375 5.8e-10
ependymoma 1.300 5.5e-06
group 3 medulloblastoma 3.000 1.5e-04
atypical teratoid / rhabdoid tumor 2.000 4.6e-07
medulloblastoma, large-cell 2.500 1.1e-05
primitive neuroectodermal tumor 2.100 3.6e-05
acute quadriplegic myopathy 1.058 3.0e-04
pediatric high grade glioma 1.500 2.8e-04
nasopharyngeal carcinoma 1.100 1.7e-04
Pick disease -1.600 8.4e-06
progressive supranuclear palsy -1.500 1.2e-02
ovarian cancer -2.600 5.1e-09

Gene RIF (13)

PMID Text
26333388 Host RBMX is required for the maintenance of Borna disease virus nuclear viral factories.
25884434 Results showed that HNRNPG and HTRA2-BETA1 were specific antagonistic regulators of ERa exon7 splicing and increased HNRNPG levels were associated with improved clinical outcome of endometrial cancer through up-regulation of ERaD7 expression.
25256757 A sequence deletion within RBMX is identified as associated with with Shashi X-linked intellectual disability syndrome.
23125841 Tandem affinity purification and mass spectrometry analysis identify X-linked RNA binding motif protein (RBMX; hnRNP-G), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22832223 RBMX is a cohesion regulator that maintains the proper cohesion of sister chromatids.
22344029 Data show that RBMX accumulated at DNA lesions through multiple domains in a poly(ADP-ribose) polymerase 1-dependent manner and promoted HR by facilitating proper BRCA2 expression.
21840245 studied the genetic and expression states of hnRNP G in normal, premalignant and malignant human oral tissues to further understand the relationship between the hnRNP G alterations and the development of human oral cancer
18541147 These studies indicate that hnRNP G promotes the expression of Txnip and mediates its tumor-suppressive effect.
18445477 This identifies RBMX as an ARTS-1-associated protein that regulates both the constitutive release of TNFR1 exosome-like vesicles and the inducible proteolytic cleavage of TNFR1 ectodomains.
17387044 p53 modulates DNA DSB repair by, in part, inducing hnRNP G
16552754 From these results, it seems that the X-chromosome, through its RBM genes, plays a formerly unknown role in the regulation of programmed cell death (apoptosis) in breast cancer.
16491274 Observational study of gene-disease association. (HuGE Navigator)
16491274 evidence provided that deletions in or around RBMX may be involved in non-obstructive azoospermia(NOA)

AA Sequence

MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN      1 - 70
GKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNM     71 - 140
SSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPR    141 - 210
DDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGS    211 - 280
YRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLP    281 - 350
PSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY                                 351 - 391
//

Text Mined References (63)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26333388 2015 X-linked RNA-binding motif protein (RBMX) is required for the maintenance of Borna disease virus nuclear viral factories.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884434 2015 HNRNP G and HTRA2-BETA1 regulate estrogen receptor alpha expression with potential impact on endometrial cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25256757 2015 The RBMX gene as a candidate for the Shashi X-linked intellectual disability syndrome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22832223 2012 RBMX: a regulator for maintenance and centromeric protection of sister chromatid cohesion.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22344029 2012 A genome-wide homologous recombination screen identifies the RNA-binding protein RBMX as a component of the DNA-damage response.
21840245 2011 Expression and mutation analysis of heterogeneous nuclear ribonucleoprotein G in human oral cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21327109 Novel domains in the hnRNP G/RBMX protein with distinct roles in RNA binding and targeting nascent transcripts.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19282290 2009 Heterogeneous nuclear ribonucleoprotein G regulates splice site selection by binding to CC(A/C)-rich regions in pre-mRNA.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18541147 2008 hnRNP G elicits tumor-suppressive activity in part by upregulating the expression of Txnip.
18445477 2008 An association between RBMX, a heterogeneous nuclear ribonucleoprotein, and ARTS-1 regulates extracellular TNFR1 release.
17890166 2007 The nuclear PP1 interacting protein ZAP3 (ZAP) is a putative nucleoside kinase that complexes with SAM68, CIA, NF110/45, and HNRNP-G.
17387044 2007 p53 promotes the fidelity of DNA end-joining activity by, in part, enhancing the expression of heterogeneous nuclear ribonucleoprotein G.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16707624 2006 Heterogeneous nuclear ribonucleoprotein G shows tumor suppressive effect against oral squamous cell carcinoma cells.
16677675 2006 Use of a recombinant protein containing major epitopes of hnRNP G to detect anti-hnRNP G antibodies in dogs with systemic lupus erythematosus.
16552754 2006 Positive correlation between the expression of X-chromosome RBM genes (RBMX, RBM3, RBM10) and the proapoptotic Bax gene in human breast cancer.
16491274 2006 Associations of homologous RNA-binding motif gene on the X chromosome (RBMX) and its like sequence on chromosome 9 (RBMXL9) with non-obstructive azoospermia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12761049 2003 HnRNP G and Tra2beta: opposite effects on splicing matched by antagonism in RNA binding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12165565 2002 hnRNP-G promotes exon 7 inclusion of survival motor neuron (SMN) via direct interaction with Htra2-beta1.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11420617 2001 Expression and conservation of processed copies of the RBMX gene.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
10749975 2000 RBMY, a probable human spermatogenesis factor, and other hnRNP G proteins interact with Tra2beta and affect splicing.
10391207 1999 RBMY evolved on the Y chromosome from a ubiquitously transcribed X-Y identical gene.
10391206 1999 The candidate spermatogenesis gene RBMY has a homologue on the human X chromosome.
10332027 1999 T-STAR/ETOILE: a novel relative of SAM68 that interacts with an RNA-binding protein implicated in spermatogenesis.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7692398 1993 hnRNP G: sequence and characterization of a glycosylated RNA-binding protein.
1551662 1992 Localization of the human gene encoding heterogeneous nuclear RNA ribonucleoprotein G (hnRNP-G) to chromosome 6p12.