Property Summary

NCBI Gene PubMed Count 50
PubMed Score 47.55
PubTator Score 82.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial lung disease 1.100 2.7e-02
astrocytic glioma 2.200 1.3e-02
ependymoma 2.500 1.6e-02
oligodendroglioma 2.400 1.2e-02
psoriasis -3.800 3.9e-05
osteosarcoma -1.248 1.9e-04
intraductal papillary-mucinous adenoma (... 1.300 5.1e-03
intraductal papillary-mucinous carcinoma... 1.600 7.7e-04
Pick disease -2.000 3.8e-07
progressive supranuclear palsy -1.700 1.1e-02
ovarian cancer -1.800 1.3e-08
Breast cancer -1.400 7.2e-09
Gaucher disease type 1 -1.600 1.4e-02

 GWAS Trait (1)

Protein-protein Interaction (159)

Gene RIF (28)

PMID Text
25738917 ICG-001 had no apparent effect on the RBM5 levels.
25586139 RBM5 knockdown in human neuronal cells decreases caspase activation by staurosporine.
24332178 Antagonizes the effects of RBM5, RBM6, and RBM10 in cell colony formation.
23721095 Loss of RBM5 expression is associated with lung adenocarcinoma.
23158838 expression of RBM5 protein was significantly decreased in cancerous prostatic tissues compared to the normal tissues
23017209 RBM5 promotes exon 4 skipping of AID pre-mRNA by competing with the binding of U2AF65 to the polypyrimidine tract.
22882865 The results suggest that RBM5 expression is not directly regulated by EGFR in non-smoker related lung adenocarinomas.
22866867 RBM5 can inhibit the growth of lung cancer cells and induce apoptosis both in vitro and in vivo.
22839758 NMR data analysis of RBM5 RRM2 reveals several features of protein-RNA interfaces. The most striking observation is the presence of two preferred target RNA sequences, the sequences [5'-(CUCUUC)-3'] and [5'-(GAGAAG)-3'].
22609235 RBM5 may serve as a biomarker with the ability to predict a response to cisplatin
22569250 Data suggest that G-patch domain of RBM5 is indispensable for its ability to interact with DHX15; RBM5 stimulates helicase activity of DHX15 in a G-patch domain-dependent manner.
22537942 Expression of RBM5 mRNA and protein was negatively correlated with expression of EGFR and KRAS mRNA and protein in NSCLC tissues.
20338664 alters expression of genes involved in metastasis
20309933 p53 transactivation is involved in the antiproliferative activity of the putative tumor suppressor RBM5.
19559772 LUST is a novel, functional, non-coding RNA that plays a role in determining the apoptotic fate of a cell by regulating the expression of RBM5 splice variants.
18854154 Knockdown of RNA binding motif protein 5 (RBM5) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18851835 RBM5 inhibits the transition between prespliceosomal complexes assembled around exon 6 to mature spliceosomes assembled on the flanking introns and promotes sequence-specific pairing of the distal splice sites.
18840686 RBM5 binds to casp-2 pre-mRNA at a U/C-rich sequence immediately upstream of the previously identified In100 splicing repressor element
18038152 suggest some of the possible, further- alternative means of the H37/RMB5 gene expression loss in tumor, including defects in transcription and post-transcriptional/translational modifications as well as mechanisms related to haploinsufficiency
17908320 In breast tumour tissue, chimeric expression was associated with elevated levels of RBM5 mRNA, and increased tumour size.
17606309 specific allele types at C1138T and C2185T single nucleotide polymorphisms positions are correlated with different histological subtypes of non-small cell lung cancer
16945339 analysis of Hedgehog modulator properties after functional coupling of Smoothened to G15
16927403 Results suggest that reversible phosphorylation of RBM5 is a mechanism capable of regulating RBM5 participation in modulating apoptosis, and perhaps tumour suppression.
16585163 H37 was transfected into A549 non-small cell lung cancer cells. A549/H37 cells show significant growth inhibition compared with the vector controls by in vitro and in vivo cell proliferation assays.
16546166 Results suggest that LUCA-15 plays a central role in regulating cell fate consistent with its tumor suppressor activity.
15338470 Results provide the first evidence of an apoptotic modulatory role for LUCA-15 in MCF-7 breast carcinoma cell line, which is a non-T cell line.
15192330 LUCA-15/RMB5 sensitises Jurkat cells to apoptosis initiated by anti-Fas antibody, TNF-alpha, or TRAIL.
12581154 Over-expression of the splice variant LUCA15 shortened the cell cycle and inhibited CD95-mediated apoptosis in CEM-C7 T-cells.

AA Sequence

MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSPERERERRNSD      1 - 70
RSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSR     71 - 140
GFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFD    141 - 210
SEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQ    211 - 280
LSSAMDASQLLQILQSLHPPLKIDGKTIGVDFAKSARKDLVLSDGNRVSAFSVASTAIAAAQWSSTQSQS    281 - 350
GEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS    351 - 420
NPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNS    421 - 490
LTQQYLYWDGEKETYVPAAESSSHQQSGLPPAKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKN    491 - 560
SFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYSGDSDNEEEL    561 - 630
VERLESEEEKLADWKKMACLLCRRQFPNKDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMK    631 - 700
YRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGIT    701 - 770
APIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME                             771 - 815
//

Text Mined References (62)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25738917 2015 RNA-binding motif protein 5 negatively regulates the activity of Wnt/?-catenin signaling in cigarette smoke-induced alveolar epithelial injury.
25586139 2015 The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice.
24332178 2013 RBM5, 6, and 10 differentially regulate NUMB alternative splicing to control cancer cell proliferation.
24304693 2014 Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23935508 2013 RBM5 is a male germ cell splicing factor and is required for spermatid differentiation and male fertility.
23721095 2013 Tumor suppressor gene RBM5 delivered by attenuated Salmonella inhibits lung adenocarcinoma through diverse apoptotic signaling pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23158838 2012 3p21.3 tumor suppressor gene RBM5 inhibits growth of human prostate cancer PC-3 cells through apoptosis.
23017209 2012 RBM5 promotes exon 4 skipping of AID pre-mRNA by competing with the binding of U2AF65 to the polypyrimidine tract.
22882865 2012 Downregulating activated epidermal growth factor receptor has no effect on RBM5 expression.
22866867 2012 The tumor suppressor gene RBM5 inhibits lung adenocarcinoma cell growth and induces apoptosis.
22839758 2012 Solution structure of the second RRM domain of RBM5 and its unusual binding characters for different RNA targets.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22609235 2012 The 3p21.3 tumor suppressor RBM5 resensitizes cisplatin-resistant human non-small cell lung cancer cells to cisplatin.
22569250 2012 Tumor suppressor RBM5 directly interacts with the DExD/H-box protein DHX15 and stimulates its helicase activity.
22537942 2012 Differential expression of RBM5, EGFR and KRAS mRNA and protein in non-small cell lung cancer tissues.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20338664 2010 RBM5/H37 tumor suppressor, located at the lung cancer hot spot 3p21.3, alters expression of genes involved in metastasis.
20309933 2011 p53 transactivation is involved in the antiproliferative activity of the putative tumor suppressor RBM5.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19559772 2009 Identification and characterisation of a novel antisense non-coding RNA from the RBM5 gene locus.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18951082 2008 Death by splicing: tumor suppressor RBM5 freezes splice-site pairing.
18851835 2008 RBM5/Luca-15/H37 regulates Fas alternative splice site pairing after exon definition.
18840686 2008 Up-regulation of the proapoptotic caspase 2 splicing isoform by a candidate tumor suppressor, RBM5.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18587224 2008 [The possible curative therapy for rheumatoid arthritis--EBV infection control gene SAP and its application].
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18038152 2008 Promoter methylation study of the H37/RBM5 tumor suppressor gene from the 3p21.3 human lung cancer tumor suppressor locus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17908320 2007 RBM6-RBM5 transcription-induced chimeras are differentially expressed in tumours.
17606309 2007 The two single nucleotide polymorphisms in the H37/RBM5 tumour suppressor gene at 3p21.3 correlated with different subtypes of non-small cell lung cancers.
17332742 2007 Composition and three-dimensional EM structure of double affinity-purified, human prespliceosomal A complexes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16927403 The apoptosis modulator and tumour suppressor protein RBM5 is a phosphoprotein.
16585163 2006 3p21.3 tumor suppressor gene H37/Luca15/RBM5 inhibits growth of human lung cancer cells through cell cycle arrest and apoptosis.
16546166 2006 Candidate tumor suppressor LUCA-15/RBM5/H37 modulates expression of apoptosis and cell cycle genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15338470 Genetic instability of RBM5/LUCA-15/H37 in MCF-7 breast carcinoma sublines may affect susceptibility to apoptosis.
15192330 2004 LUCA-15/RBM5, a putative tumour suppressor, enhances multiple receptor-initiated death signals.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12581154 2003 Simultaneous acceleration of the cell cycle and suppression of apoptosis by splice variant delta-6 of the candidate tumour suppressor LUCA-15/RBM5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12207175 2002 Candidate tumour suppressor LUCA-15 can regulate multiple apoptotic pathways.
12036935 2002 A candidate tumor suppressor gene, H37, from the human lung cancer tumor suppressor locus 3p21.3.
10949932 2000 LUCA-15-encoded sequence variants regulate CD95-mediated apoptosis.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10497265 1999 Identification of differentially expressed genes associated with HER-2/neu overexpression in human breast cancer cells.
10486216 1999 An evolutionary rearrangement of the Xp11.3-11.23 region in 3p21.3, a region frequently deleted in a variety of cancers.
10352938 A comparison of genomic structures and expression patterns of two closely related flanking genes in a critical lung cancer region at 3p21.3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.