Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.17
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.500 1.7e-06
psoriasis -2.500 2.0e-04
osteosarcoma -2.598 7.1e-08
medulloblastoma, large-cell -1.100 2.1e-04
juvenile dermatomyositis 1.014 3.2e-07
colon cancer 1.100 1.4e-03
group 3 medulloblastoma 1.500 3.8e-03
aldosterone-producing adenoma -1.131 1.4e-02
spina bifida -1.582 4.3e-02
acute myeloid leukemia 1.100 2.4e-02

Synonym

Accession Q5RL73 B7Z2K5 B7ZL51 Q5H9T2 Q8IYW7 Q96NS0 Q9H0V7
Symbols C7orf64
HSPC304
MGC16142

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASSGGELGSLFDHHVQRAVCDTRAKYREGRRPRAVKVYTINLESQYLLIQGVPAVGVMKELVERFALYG      1 - 70
AIEQYNALDEYPAEDFTEVYLIKFMNLQSARTAKRKMDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKA     71 - 140
YVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGFCKAALNTSAGNSNPYLPYSCELPLCYFSSKC    141 - 210
MCSSGGPVDRAPDSSKDGRNHHKTMGHYNHNDSLRKTQINSLKNSVACPGAQKAITSSEAVDRFMPRTTQ    211 - 280
LQERKRRREDDRKLGTFLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPKPPED    281 - 350
KPEDVHTSHPLKQRRRI                                                         351 - 367
//

Text Mined References (9)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.