Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.20
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.100 2.4e-02
aldosterone-producing adenoma -1.131 1.4e-02
colon cancer 1.100 1.4e-03
group 3 medulloblastoma 1.500 3.8e-03
juvenile dermatomyositis 1.014 3.2e-07
malignant mesothelioma 1.500 1.7e-06
medulloblastoma, large-cell -1.100 2.1e-04
osteosarcoma -2.598 7.1e-08
psoriasis -2.500 2.0e-04
spina bifida -1.582 4.3e-02

AA Sequence

MASSGGELGSLFDHHVQRAVCDTRAKYREGRRPRAVKVYTINLESQYLLIQGVPAVGVMKELVERFALYG      1 - 70
AIEQYNALDEYPAEDFTEVYLIKFMNLQSARTAKRKMDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKA     71 - 140
YVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGFCKAALNTSAGNSNPYLPYSCELPLCYFSSKC    141 - 210
MCSSGGPVDRAPDSSKDGRNHHKTMGHYNHNDSLRKTQINSLKNSVACPGAQKAITSSEAVDRFMPRTTQ    211 - 280
LQERKRRREDDRKLGTFLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPKPPED    281 - 350
KPEDVHTSHPLKQRRRI                                                         351 - 367
//

Text Mined References (9)

PMID Year Title