Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.93
PubTator Score 3.13

Knowledge Summary


No data available


  Differential Expression (24)

Gene RIF (2)

24898756 RBM47 is an RNA-binding protein that can suppress breast cancer progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

AAAAMYGGYAGYIPQAFPAAAIQVPIPDVYQTY                                         561 - 593

Text Mined References (14)

PMID Year Title
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24898756 2014 Loss of the multifunctional RNA-binding protein RBM47 as a source of selectable metastatic traits in breast cancer.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.