Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.65
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.800 4.3e-05
Astrocytoma, Pilocytic 1.900 4.8e-07
Breast cancer -1.100 3.8e-07
ependymoma 2.300 2.5e-15
glioblastoma 1.800 4.3e-09
invasive ductal carcinoma -1.200 1.3e-02
juvenile dermatomyositis 1.148 1.3e-12
osteosarcoma 1.250 3.3e-03
ovarian cancer -2.000 6.0e-10
pituitary cancer 1.100 1.4e-02

 GO Function (1)

AA Sequence

MASVLNVKESKAPERTVVVAGLPVDLFSDQLLAVLVKSHFQDIKNEGGDVEDVIYPTRTKGVAYVIFKEK      1 - 70
KVAENVIRQKKHWLARKTRHAELTVSLRVSHFGDKIFSSVNAILDLSVFGKEVTLETLVKDLKKKIPSLS     71 - 140
FSPLKPNGRISVEGSFLAVKRLRESLLARACSLLEKDRNFTSEERKWNRQNPQRNLQRSNNSLASVRTLV    141 - 210
PETARSGEMLVLDTDVFLYLKHKCGSYESTLKKFHILSQEKVDGEITTICLKSIQVGSQPNNAKHVKELI    211 - 280
EEWSHALYLKLRKETFILEGKENREKRMIKRACEQLSSRYLEVLINLYRTHIDIIGSSSDTYLFKKGVMK    281 - 350
LIGQKVS                                                                   351 - 357
//

Text Mined References (6)

PMID Year Title