Property Summary

NCBI Gene PubMed Count 30
PubMed Score 6.33
PubTator Score 26.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.500 4.6e-02
astrocytic glioma 1.400 5.8e-03
ependymoma 1.800 2.7e-02
oligodendroglioma 1.300 3.0e-02
atypical teratoid / rhabdoid tumor 1.300 1.1e-05
juvenile dermatomyositis 1.008 2.4e-05
pancreatic ductal adenocarcinoma liver m... 1.654 7.2e-03
intraductal papillary-mucinous adenoma (... 1.500 1.4e-04
intraductal papillary-mucinous carcinoma... 1.500 6.3e-05
adult high grade glioma 1.500 2.7e-04
acute myeloid leukemia 1.400 3.4e-02
psoriasis -1.100 3.1e-08
Pick disease 1.600 9.5e-04
ovarian cancer -2.200 8.0e-09

Gene RIF (11)

PMID Text
27018250 mammalian c-Abl plays an important role in steroid hormone receptor-mediated transcription by regulating RBM39
24795046 identify SF3b155 as the relevant ULM-containing partner of full-length CAPERalpha in human cell extracts.
24643682 Our data suggest that overexpression of HCC1/CAPERalpha may increase the proliferation and migration of NSCLC cells, and HCC1/CAPERalpha could be a promising biomarker for lung cancer
24621503 Knockdown of CAPER expression markedly reduced human breast cancer cell proliferation in both in vitro and in vivo settings. Mechanistically, knockdown of CAPER abrogated the activity of proliferative and protein synthesis pathways.
22711543 Data show that CSE1L, DIDO1 and RBM39 mRNA expression levels correlated with chromosome 20q DNA copy number status.
22174317 HIV-1 Rev interacting protein, RNA binding motif protein 39 (RBM39), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with RBM39 is increased by RRE
22009261 Increased VEGF(165) expression is secondary to the down-regulation of CAPER-alpha by EWS/FLI-1. CAPER-alpha mediates alternative splicing and controls the shift from VEGF(189) to VEGF(165) .
19342371 Analysis of human breast cancer samples revealed that CAPER is overexpressed and undergoes a cytoplasmic-to-nuclear shift during the transition from pre-malignancy to ductal carcinoma in situ
18753212 this study identifies CAPERalpha (RNA binding motif protein 39) as a new transcriptional coregulator for v-Rel and reveals an important role in modulating Rel's oncogenic activity.
15747776 10 genes were down-regulated following treatment of the T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h
11704680 This paper describes the mouse gene.

AA Sequence

MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRE      1 - 70
RKRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE     71 - 140
PIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLA    141 - 210
IGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQ    211 - 280
LMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGID    281 - 350
LGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQP    351 - 420
LATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNA    421 - 490
LHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR                                  491 - 530
//

Text Mined References (42)

PMID Year Title
27018250 2016 Functional interaction between nonreceptor tyrosine kinase c-Abl and SR-Rich protein RBM39.
25416956 2014 A proteome-scale map of the human interactome network.
24795046 2014 Cancer-relevant splicing factor CAPER? engages the essential splicing factor SF3b155 in a specific ternary complex.
24643682 2014 Overexpression of HCC1/CAPER? may play a role in lung cancer carcinogenesis.
24621503 2014 CAPER, a novel regulator of human breast cancer progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22711543 2012 CSE1L, DIDO1 and RBM39 in colorectal adenoma to carcinoma progression.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22009261 2012 CAPER-? alternative splicing regulates the expression of vascular endothelial growth factor??? in Ewing sarcoma cells.
21551269 2011 The origins, evolution, and functional potential of alternative splicing in vertebrates.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20515076 2010 Proteomic analysis of nuclei isolated from cancer cell lines treated with indenoisoquinoline NSC 724998, a novel topoisomerase I inhibitor.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19381943 2009 Identification of tumor-associated antigens as diagnostic and predictive biomarkers in cancer.
19342371 2009 Genetic ablation of caveolin-1 drives estrogen-hypersensitivity and the development of DCIS-like mammary lesions.
18753212 2008 CAPERalpha is a novel Rel-TAD-interacting factor that inhibits lymphocyte transformation by the potent Rel/NF-kappaB oncoprotein v-Rel.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559666 2008 Spatial mapping of splicing factor complexes involved in exon and intron definition.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15798186 2005 A novel SR-related protein is required for the second step of Pre-mRNA splicing.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15694343 2005 Steroid hormone receptor coactivation and alternative RNA splicing by U2AF65-related proteins CAPERalpha and CAPERbeta.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11704680 2002 Molecular cloning and characterization of CAPER, a novel coactivator of activating protein-1 and estrogen receptors.
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.
8227358 1993 Novel nuclear autoantigen with splicing factor motifs identified with antibody from hepatocellular carcinoma.