Property Summary

NCBI Gene PubMed Count 31
PubMed Score 20.80
PubTator Score 15.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 3.100 8.3e-09
psoriasis -1.200 1.1e-03
osteosarcoma -3.949 1.8e-05
posterior fossa group B ependymoma 1.100 6.5e-06
gastric carcinoma 1.400 4.0e-02

Gene RIF (19)

PMID Text
26740055 RBM38 and DND1 are repressed in primary acute myeloid leukemia, neutrophil differentiation is dependent on increased expression of both proteins, and they have a role in regulating p21(CIP1) expression during acute promyelocytic leukemia differentiation
26046131 RNPC1 was found to be expressed in bladder, blood, brain, breast, colorectal, eye, head and neck, lung, ovarian, skin and soft tissue cancer. In 14 of the 94 tests, an association between RNPC1 gene expression and cancer prognosis was observed.
25622105 our data suggest that RBM38 is a novel translational regulator of HIF1alpha under a hypoxic condition.
24884756 Suggest that RNPC1 had a potential function to play a tumor-suppressor role which may be a potential marker in the therapeutic and prognostic of breast cancer.
24663081 Data indicate that long non-coding RNA HOTAIR is functionally related to RNA binding motif protein 38 (RBM38).
24250749 A role for RBM38 in regulating alternative splicing during erythroid differentiation.
24142875 GSK3 promotes p53 mRNA translation through phosphorylation of RNPC1
23912475 Data suggest that RNPC1 is a critical regulator of Mdm2.
23836903 knockdown of MIC-1 can decrease RNPC1-induced cell growth suppression.
22798430 RBM38 as novel transcriptional target of E2F1 restricts E2F1-induced proliferation. Furthermore, this negative feedback loop seems to restrict tumor aggressiveness, thereby promoting survival of patients with cancer.
22710720 Novel regulation of MDM2 gene expression by the RNA binding protein RNPC1 via mRNA stability.
22508983 knockdown of p73 or p21, another target of RNPC1, attenuates the inhibitory effect of RNPC1 on cell proliferation and premature senescence, whereas combined knockdown of p73 and p21 completely abolishes it
22371495 a novel mechanism by which HuR is regulated by RNPC1 via mRNA stability and HuR is a mediator of RNPC1-induced growth suppression.
22214381 RNPC1 contributes to tumor resistance to radiotherapy, which likely occurs through a p21-mediated G/G accumulation mechanism
22027593 identify RBM38 in a genetic screen for RBPs whose expression controls miRNA access to target mRNAs
21764855 identified RNPC1, a p53 target and a RNA-binding protein, as a critical regulator of p53 translation
20457941 found that RNPC1, a RNA-binding protein and a target of the p53 family, regulates p63 mRNA stability and consequently p63 activity.
19817877 it was found that this protein Rbm38 regulates myogenic differentiation via the p21 signal pathway.
17050675 RNPC1a is required to maintain the stability of p21 transcript induced by p53.

AA Sequence

MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQ      1 - 70
TGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGL     71 - 140
TPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAA    141 - 210
VPQALSAAAPAGTTFVQYQAPQLQPDRMQ                                             211 - 239
//

Text Mined References (31)

PMID Year Title
26740055 2016 The RNA binding proteins RBM38 and DND1 are repressed in AML and have a novel function in APL differentiation.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
26046131 2015 Integrative genomic analyses of the RNA-binding protein, RNPC1, and its potential role in cancer prediction.
25622105 2015 Hypoxia-inducible factor 1 alpha is regulated by RBM38, a RNA-binding protein and a p53 family target, via mRNA translation.
24884756 2014 RNA-binding protein RNPC1: acting as a tumor suppressor in breast cancer.
24663081 2014 Long non-coding RNA HOTAIR promotes cell migration and invasion via down-regulation of RNA binding motif protein 38 in hepatocellular carcinoma cells.
24250749 2013 The RNA binding protein RBM38 (RNPC1) regulates splicing during late erythroid differentiation.
24142875 2013 Glycogen synthase kinase 3 promotes p53 mRNA translation via phosphorylation of RNPC1.
23912475 2013 Regulation of Mdm2 mRNA stability by RNA-binding protein RNPC1.
23836903 2013 RNPC1, an RNA-binding protein and a p53 target, regulates macrophage inhibitory cytokine-1 (MIC-1) expression through mRNA stability.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22798430 2012 RBM38 is a direct transcriptional target of E2F1 that limits E2F1-induced proliferation.
22710720 2013 MDM2 expression is repressed by the RNA-binding protein RNPC1 via mRNA stability.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22508983 2012 p73 expression is regulated by RNPC1, a target of the p53 family, via mRNA stability.
22371495 2012 The RNA-binding protein RNPC1 stabilizes the mRNA encoding the RNA-binding protein HuR and cooperates with HuR to suppress cell proliferation.
22214381 2012 Radiation sensitivity of esophageal adenocarcinoma: the contribution of the RNA-binding protein RNPC1 and p21-mediated cell cycle arrest to radioresistance.
22027593 2011 Selective inhibition of microRNA accessibility by RBM38 is required for p53 activity.
21764855 2011 Translational repression of p53 by RNPC1, a p53 target overexpressed in lymphomas.
20457941 2010 RNPC1, an RNA-binding protein and a target of the p53 family, regulates p63 expression through mRNA stability.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19817877 2009 RNA-binding proteins Rbm38 and Rbm24 regulate myogenic differentiation via p21-dependent and -independent regulatory pathways.
19285943 2009 ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.
17050675 2006 RNPC1, an RNA-binding protein and a target of the p53 family, is required for maintaining the stability of the basal and stress-induced p21 transcript.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200376 2002 Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.