Property Summary

NCBI Gene PubMed Count 30
PubMed Score 57.31
PubTator Score 41.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26825461 The results indicate the existence of a negative feedback loop that regulates fever via reduced RBM3 levels and increased expression of miR-142-5p and miR-143.
26577765 Low RBM3 immunoexpression is associated with urothelial carcinoma of the bladder.
25811459 RBM3 may be a potential biomarker for treatment stratification in patients with metastatic non-seminomatous germ cell tumours.
24380696 High RBM3 expression is an independent prognostic marker in prostate cancer.
23673116 The data suggest that the overexpression of RBM3 may serve as an important molecular mechanism underlying astrocytic carcinogenesis.
23667174 A novel role of RBM3 in linking stress-regulated RNA splicing to tumorigenesis.
23565664 Loss of RBM3 expression is associated with more aggressive tumors and poorer prognosis of urothelial bladder cancer. Findings may indicate that loss of RBM3 expression results in a phenotype more prone to metastatic spread than local aggressiveness.
22805320 the inverse association and prognostic impact of MCM3 and RBM3 expression indicate a possible interaction of these proteins in melanoma progression
21956899 high tumor-specific nuclear expression of RBM3 is an independent predictor of good prognosis in colorectal cancer
21955582 high nuclear expression of RBM3 in prostate cancer is associated with a prolonged time to disease progression
21777469 RBM3 is down-regulated in metastatic melanoma and high nuclear RBM3 expression in the primary tumour is an independent marker of a prolonged overal survival.
20727170 RBM3 may be a useful prognostic and treatment predictive marker in epithelial ovarian cancer.
19770690 RBM3 is a critical factor providing cellular survival advantages in an adverse microenvironment presumably by restoring translation efficacy
19734850 Nuclear RBM3 is an independent favorable prognostic factor in breast cancer, and seems to have a specific role in estrogen receptor-positive tumors.
19277990 pharmacological modulation of RBM3 and CIRBP may represent novel therapeutic approaches for prostate cancer.
18427544 the RNA stabilizing and translation regulatory protein RBM3 is a novel proto-oncogene that induces transformation when overexpressed and is essential for cells to progress through mitosis.
16552754 From these results, it seems that the X-chromosome, through its RBM genes, plays a formerly unknown role in the regulation of programmed cell death (apoptosis) in breast cancer.
15075239 RBM3 and CIRP are adaptatively expressed in response to hypoxia by a mechanism that involves neither HIF-1 nor mitochondria

AA Sequence

MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGE      1 - 70
SLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQ     71 - 140
GGYDRYSGGNYRDNYDN                                                         141 - 157
//

Text Mined References (35)

PMID Year Title
26825461 2016 RBM3 regulates temperature sensitive miR-142-5p and miR-143 (thermomiRs), which target immune genes and control fever.
26577765 2015 Evaluation of RNA-binding motif protein 3 expression in urothelial carcinoma of the bladder: an immunohistochemical study.
25811459 2015 Low RBM3 protein expression correlates with clinical stage, prognostic classification and increased risk of treatment failure in testicular non-seminomatous germ cell cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24380696 2014 High RNA-binding motif protein 3 expression is an independent prognostic marker in operated prostate cancer and tightly linked to ERG activation and PTEN deletions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23673116 2013 Differential expression of the RNA-binding motif protein 3 in human astrocytoma.
23667174 2013 Stress-response protein RBM3 attenuates the stem-like properties of prostate cancer cells by interfering with CD44 variant splicing.
23565664 2013 Decreased expression of RNA-binding motif protein 3 correlates with tumour progression and poor prognosis in urothelial bladder cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22805320 2012 High MCM3 expression is an independent biomarker of poor prognosis and correlates with reduced RBM3 expression in a prospective cohort of malignant melanoma.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21956899 2011 High nuclear RBM3 expression is associated with an improved prognosis in colorectal cancer.
21955582 2011 High RBM3 expression in prostate cancer independently predicts a reduced risk of biochemical recurrence and disease progression.
21777469 2011 Low RBM3 protein expression correlates with tumour progression and poor prognosis in malignant melanoma: an analysis of 215 cases from the Malmö Diet and Cancer Study.
21269460 2011 Initial characterization of the human central proteome.
20727170 2010 Expression of the RNA-binding protein RBM3 is associated with a favourable prognosis and cisplatin sensitivity in epithelial ovarian cancer.
19770690 2010 The RNA-binding protein RBM3 is required for cell proliferation and protects against serum deprivation-induced cell death.
19734850 2009 Nuclear expression of the RNA-binding protein RBM3 is associated with an improved clinical outcome in breast cancer.
19277990 2009 Down-regulating cold shock protein genes impairs cancer cell survival and enhances chemosensitivity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18427544 2008 Translation regulatory factor RBM3 is a proto-oncogene that prevents mitotic catastrophe.
16552754 2006 Positive correlation between the expression of X-chromosome RBM genes (RBMX, RBM3, RBM10) and the proapoptotic Bax gene in human breast cancer.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15772651 2005 The DNA sequence of the human X chromosome.
15635413 2005 Nucleolar proteome dynamics.
15518812 2004 Protein interactions among the vaccinia virus late transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15075239 2004 Oxygen-regulated expression of the RNA-binding proteins RBM3 and CIRP by a HIF-1-independent mechanism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9245737 1997 Increased transcript level of RBM3, a member of the glycine-rich RNA-binding protein family, in human cells in response to cold stress.
8634703 1995 RBM3, a novel human gene in Xp11.23 with a putative RNA-binding domain.