| Tdark | Probable RNA-binding protein 23 |
Probable RNA-binding protein. May be involved in pre-mRNA splicing process.
This gene encodes a member of the U2AF-like family of RNA binding proteins. This protein interacts with some steroid nuclear receptors, localizes to the promoter of a steroid- responsive gene, and increases transcription of steroid-responsive transcriptional reporters in a hormone-dependent manner. It is also implicated in the steroid receptor-dependent regulation of alternative splicing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
This gene encodes a member of the U2AF-like family of RNA binding proteins. This protein interacts with some steroid nuclear receptors, localizes to the promoter of a steroid- responsive gene, and increases transcription of steroid-responsive transcriptional reporters in a hormone-dependent manner. It is also implicated in the steroid receptor-dependent regulation of alternative splicing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8491 | 4.2e-05 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Progressive multifocal leukoencephalopathy | 24 | 3.049 | 1.5 |
MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSKKKRSRSHNKS 1 - 70 RDRKRSRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHS 71 - 140 KSPHFREKSPVREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIA 141 - 210 YVEFCEIQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITEDMLR 211 - 280 GIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDIT 281 - 350 FPDGDQELDLGSAGGRFQLMAKLAEGAGIQLPSTAAAAAAAAAQAAALQLNGAVPLGALNPAALTALSPA 351 - 420 LNLASQCFQLSSLFTPQTM 421 - 439 //
| PMID | Year | Title | |
|---|---|---|---|
| 26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 23602568 | 2013 | The protein interaction landscape of the human CMGC kinase group. | |
| 23455924 | 2013 | A Y2H-seq approach defines the human protein methyltransferase interactome. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22365833 | 2012 | Dynamic protein-protein interaction wiring of the human spliceosome. | |
| 21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. | |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. | |
| 19690332 | 2009 | Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. | |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. | |
| 17081983 | 2006 | Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. | |
| 16169070 | 2005 | A human protein-protein interaction network: a resource for annotating the proteome. | |
| 15694343 | 2005 | Steroid hormone receptor coactivation and alternative RNA splicing by U2AF65-related proteins CAPERalpha and CAPERbeta. | |
| 15498874 | 2004 | Large-scale cDNA transfection screening for genes related to cancer development and progression. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12508121 | 2003 | The DNA sequence and analysis of human chromosome 14. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. |
