Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.2e-05
osteosarcoma 7950 2.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.193 2.3e-04
ovarian cancer -1.200 7.2e-05

Gene RIF (1)

AA Sequence

MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRG      1 - 70
YCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVT     71 - 140
AKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR                        141 - 190
//

Text Mined References (9)

PMID Year Title