Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.2e-08
lung cancer 4473 5.9e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.339 1.2e-08
lung cancer 1.600 5.9e-05

Synonym

Accession Q9P1G2
Symbols C8orf39
PRO1905

 Compartment GO Term (0)

AA Sequence

MAQDFSQHPQTGIIRRHRFYSPKPLSTTPRGQSFLLSRQAKVATWDPMLSPDFQPKSAFKLTWTAQPPCL      1 - 70
SVTPSQGQTFHPNSPEGELPPDLTENTCPSQA                                           71 - 102
//

Text Mined References (1)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.