Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.12
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
sarcoidosis 1.200 1.2e-02
adrenocortical carcinoma 1.012 4.5e-05
Breast cancer 2.300 4.5e-02
gastric cancer 1.100 5.6e-03
group 3 medulloblastoma 1.300 1.6e-02
hepatocellular carcinoma 1.300 1.7e-05
intraductal papillary-mucinous carcinoma... 1.100 3.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.9e-02
lung cancer 1.400 6.7e-04
malignant mesothelioma 1.200 1.3e-05
Pick disease 1.400 1.7e-05
primitive neuroectodermal tumor 1.300 3.5e-05
psoriasis -1.300 4.4e-04
tuberculosis -1.100 3.7e-03

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGEIGEAFIIFATDEDARRAISRSGGFIKDSSVE      1 - 70
LFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYGSSINQDAGFHTNGTGHG     71 - 140
NLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCVDASGG    141 - 210
LKCHRSFMGSRFIEVMQGSEQQWIEFGGNAVKEGDVLRRSEEHSPPRGINDRHFRKRSHSKSPRRTRSRS    211 - 280
PLGFYVHLKNLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQY    281 - 350
RPVHIDPISRKQMLKFIARYEKKRSGSLERDRPGHVSQKYSQEGNSGQKLCIYIRNFPFDVTKVEVQKFF    351 - 420
ADFLLAEDDIYLLYDDKGVGLGEALVKFKSEEQAMKAERLNRRRFLGTEVLLRLISEAQIQEFGVNFSVM    421 - 490
SSEKMQARSQSRERGDHSHLFDSKDPPIYSVGAFENFRHQLEDLRQLDNFKHPQRDFRQPDRHPPEDFRH    491 - 560
SSEDFRFPPEDFRHSPEDFRRPREEDFRRPSEEDFRRPWEEDFRRPPEDDFRHPREEDWRRPLEEDWRRP    561 - 630
LEEDFRRSPTEDFRQLPEEDFRQPPEEDLRWLPEEDFRRPPEEDWRRPPEEDFRRPLQGEWRRPPEDDFR    631 - 700
RPPEEDFRHSPEEDFRQSPQEHFRRPPQEHFRRPPPEHFRRPPPEHFRRPPPEHFRRPPPEHFRRPPPEH    701 - 770
FRRPPPEHFRRPPQEHFRRPPQEHFRRSREEDFRHPPDEDFRGPPDEDFRHPPDEDFRSPQEEDFRCPSD    771 - 840
EDFRQLPEEDLREAPEEDPRLPDNFRPPGEDFRSPPDDFRSHRPFVNFGRPEGGKFDFGKHNMGSFPEGR    841 - 910
FMPDPKINCGSGRVTPIKIMNLPFKANVNEILDFFHGYRIIPDSVSIQYNEQGLPTGEAIVAMINYNEAM    911 - 980
AAIKDLNDRPVGPRKVKLTLL                                                     981 - 1001
//

Text Mined References (17)

PMID Year Title