Property Summary

NCBI Gene PubMed Count 46
PubMed Score 139.99
PubTator Score 23.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
TARP syndrome 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8297 5.8e-08
osteosarcoma 7766 5.0e-05
group 3 medulloblastoma 4002 1.2e-03
astrocytoma 1113 3.2e-03
lung cancer 4607 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.1
Kidney cancer 2548 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.400 3.2e-03
group 3 medulloblastoma 1.100 1.2e-03
lung cancer 1.100 2.6e-02
osteosarcoma -1.544 5.0e-05
ovarian cancer 1.900 5.8e-08

 GO Component (2)

Gene RIF (19)

AA Sequence

MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSY      1 - 70
EASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKASNIVMLRMLPQAA     71 - 140
TEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK    141 - 210
PKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQG    211 - 280
VLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQL    281 - 350
STIVEAAQLLQILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG    351 - 420
GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGPEASLEPGADS    421 - 490
VSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQSPTHPSSALPPATSPTAQES    491 - 560
YSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYVPALEQSADGHKETG    561 - 630
APSKEGKEKKEKHKTKTAQQIAKDMERWARSLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKK    631 - 700
GALAERQHTSMDLPKLASDDRPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPS    701 - 770
KEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG    771 - 840
ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTS    841 - 910
TESYKETLHKTMVTRFNEAQ                                                      911 - 930
//

Text Mined References (62)

PMID Year Title