Property Summary

NCBI Gene PubMed Count 115
PubMed Score 505.27
PubTator Score 279.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.500 1.8e-02
pancreatic cancer -1.300 1.8e-02
Waldenstrons macroglobulinemia 1.262 1.1e-03
astrocytic glioma 1.200 6.4e-03
ependymoma 1.400 1.3e-03
oligodendroglioma 1.500 1.2e-03
psoriasis -1.400 1.9e-02
atypical teratoid / rhabdoid tumor 1.800 3.5e-05
glioblastoma 1.300 1.3e-03
medulloblastoma 1.200 1.1e-02
medulloblastoma, large-cell 1.400 1.9e-05
intraductal papillary-mucinous adenoma (... 1.300 4.7e-03
lung cancer -1.300 6.1e-04
pancreatic carcinoma -1.300 1.8e-02
ovarian cancer -1.700 3.2e-08

Gene RIF (71)

PMID Text
26576645 Hepatitis C virus core protein modulates pRb2/p130 expression in human hepatocellular carcinoma cell lines through promoter methylation
26271034 Statistical analysis revealed that Rbl2/p130 expression negatively correlates to its promoter methylation (r = -0.412) in tumor tissues.
25183046 TGF-beta induced RBL2 expression through down-regulating miR-93 in renal cancer cells
24281253 the inactivation of RB1 or RB2/P130 in uncommitted bone marrow stromal cells facilitates the first steps of adipogenesis.
24189068 PRMT5 knockdown in non-Hodgkin lymphoma cell lines and primary lymphoma cells leads to RBL2 derepression and RB1 reactivation, which in turn inhibit PRC2 expression.
24045973 expression profiling of miRNAs in high-grade serous ovarian carcinoma indicated miR-106a and its family members were upregulated; findings suggest miR-106a can repress expression of the retinoblastoma family member RBL2 and miR-106a overexpression results in rapid tumor growth and poor differentiation
23377830 Low expression of RBL2 is associated with glioma.
23370776 Silencing of RB1 but not RB2/P130 decreases proliferative activity and impairs the differentiation potential of human mesenchymal stem cells.
22595804 Our hypothesis not only enrich the knowledge of the regulation of ALT, but also indicate that p130 may serve as a potential suppressor of ALT, and gene therapy of p130 may be used in cervical cancers.
21813705 The results show that continued human papillomavirus 16 E6/E7 expression is necessary in cervical cancer cells to prevent cell-cycle arrest by a repressive p130-DREAM complex.
21516817 Gsk3beta, p130 and beta-catenin form in MSC a complex the functional role of which may be associated with activation of differentiation not coupled to cell cycle arrest.
21511729 Hypoproliferation and loss of differentiation in organotypic raft cultures of primary neonatal human foreskin keratinocytes depleted of the alpha and beta isoforms of p63 result from p53-p21-mediated accumulation of retinoblastoma (Rb) family member p130.
21411531 Human papillomavirus E7 protein K39,42R mutation moderately increased the association with and the destabilization of p130.
21325284 The activity of CTCF in controlling Rb2/p130 gene expression is impaired by BORIS, which by binding to the Rb2/p130 gene could trigger changes in the chromatin asset established by CTCF affecting CTCF regulatory activity on Rb2/p130 transcription.
21127431 heterogeneous RB (pRb2 or p16) and p53 (p53, p14, or p21) pathway alterations occur frequently in Burkitt lymphoma
20800603 Observational study of gene-disease association. (HuGE Navigator)
20406986 Loss of p130 accelerates tumor development in a mouse model for human small-cell lung carcinoma.
20189212 The half-life of p130, relative to control cells, was decreased in the cytoplasm in the presence of human papillomavirus 6 E7 or human papillomavirus 16 E7, but only decreased by HPV 6 E7 in the nucleus.
20071580 Data suggest that KSHV miRNA targets multiple pathways to maintain KHSV latency, including repression of the viral protein Rta and a cellular factor, Rbl2, and increased cellular DNMT, in regulating global epigenetic reprogramming.
20009087 FTO influence RBL2 gene expression at large genetic distances
19738611 Observational study of gene-disease association. (HuGE Navigator)
19694314 We conclude that Rb2/p130 genetic alterations are infrequent in nasopharyngeal cancer and may not be essential for the pathogenesis of the disease.
19668264 p130/Rbl2 plays a role in the modulation of the cell senescence process
19648966 Data suggest that Rb2/p130 is a member of the p53-p21 DNA damage signaling cascade, and represents the essential pocket protein family member needed for the induction of any type of senescence.
19597825 pRb2/p130 was mainly localized in the cytoplasm rather than in the nucleus in rectal cancer.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19279001 Data show that RB is associated with promoters in a manner similar to p107/p130 and that association is modulated by phosphorylation during cell cycle progression.
19252413 Loss of heterozygosity within RBL2/p130 gene is associated with retinoblastoma.
19074885 Observational study of gene-disease association. (HuGE Navigator)
18676747 pRb2/p130 has a role in reducing survival in human soft tissue sarcomas
18446820 It is possible that a hyperphosphorylated form of Rb2/p130 may contribute to the resistance of ovarian carcinoma cells to ATRA mediated growth suppression
18418057 P130 may be required to prevent the onset of terminal growth arrest in unstimulated prostate cancer cells lacking a functional Rb allele.
18321970 Collectively, these data support the notion that p130 controls the homeostasis of the differentiated keratinocytes and is therefore targeted by E7 for degradation to establish conditions permissive for viral DNA amplification.
18086563 Differentiating human adipose-derived human stem cells (hASC), do not undergo clonal expansion and p130 expression gradually diminishes across differentiation. However, p107 expression is transiently increased during hASC differentiation.
17905135 There was a strong correlation between the expression of p130 in Stage 1 & 3, but not Stage 2, tumors. High levels of p130 were detected in the cytoplasm rather than the nucleus, suggesting an aberrant subcellular localization of this tumor suppressor.
17694957 no mutation of p53 and RB2/p130 genes was identified in any of the blood samples from Malaysian nasopharyngeal carcinoma
17531812 Evolutionarily conserved multisubunit protein complex that contains p130 and E2F4 mediates the repression of cell cycle-dependent genes in quiescence.
17485552 Mutated RBL2 is associated with Burkitt lymphoma
16936755 supportive role in the genesis of retinoblastoma has recently been proposed for the RB1-related gene RB2/p130. (review)
16936753 All-trans-retinoic acid (ATRA) has been shown to arrest the growth of ovarian carcinoma cells in G0/G1 and to significantly elevate levels of Rb2/p130 protein. (review)
16760287 ER-beta and pRb2/p130 proteins co-immunoprecipitate in both nucleus and cytoplasm of MCF-7 breast cancer cells. The interaction of pRb2/130 with ER-beta may have a functional significance in regulating ER-beta activity.
16537896 These results demonstrate a mechanistic role for p130 and compensatory roles for p107 and RB in the long-term senescence-like growth arrest response of breast cancer cells to DNA damage.
16364039 Involved in progression and regulation of telomerase
16135806 p130 is a trancriptional regulator of the cell cycle genes.
15949438 RBP2 resembles other chromatin-associated transcriptional regulators and RBP2 binding to activate transcription and promote differentiation.
15939381 developmental expression of RB, p130 and p107 in mouse and human retina
15827088 p130/p107/p105Rb has a role in transcriptional repression in DNA-damage-induced cell-cycle exit at G2
15696973 Rb2/ p130 expression can additionally be an indicator of a better prognosis in patients with gliomas
15467457 the PP2A catalytic subunit (PP2A/C) specifically interacts with both p130 and p107 in quiescent cells as well as cells progressing throughout the cell cycle
15231644 Disruption of E2F4 through small interfering RNA prevented p130/E2F4 complex formation and sensitized prostate cancer cells to IR-induced apoptosis.
15161709 VEGF together with pRb2/p130 may have a role in hepatocellular carcinoma in a p27((KIP1))-independent manner
15131049 pRb2/p130 overexpression is able to arrest cell growth in ovarian carcinoma cells, suggesting the putative role of pRb2/p130 as a tumor suppressor in this malignancy.
15103018 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120
15059924 pRb2/p130 has a role as a tumour suppressor protein in hepatocellular carcinoma
14671316 Induction of p130 and p107 play an important role in the inhibition of growth of C33A cells by MIS.
14587097 Reduced transcription of the RB2/p130 gene is associated with lung cancer
14534545 Rb2/P130 target genes in non-small-cell lung neoplasms are identified by microarray analysis.
13679860 The interaction between HIV-1 tat and Rb2 may be a possible mechanism in the pathogenesis of AIDS-related lymphoma.
13679860 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120
12968030 T Ag recruits a phosphatase activity in a DNA J domain-dependent manner to reduce the phosphorylation of p130
12915404 ATRA mediates growth inhibition by stabilizing Rb2/p130 via a mechanism that involves induction of PP2A, an enzyme that can potentially dephosphorylate Rb2/p130, thereby protecting it from degradation by the proteasome.
12789260 Analysis of gene expression level profiles showed that parental cell line undergoes apoptosis through an E2F1/p73-dependent pathway while its drug resistant variant evades it.
12789259 We investigated occupancy of ER-alpha promoter by pRb2/p130-E2F4/5-HDAC1-SUV39 H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 complexes, and provided a link between pRb2/p130 and chromatin-modifying enzymes in the regulation of ER-alpha transcription
12637156 reduced p130 expression may contribute to the aggressive character of anplastic carcinoma; and p130 may specify the growth characteristics of microcarcinoma
12621062 report shows hypophosphorylation of the retinoblastoma family proteins induced by H2O2 was because of the activity of protein phosphatase 2A
12474056 Expression of this gene predicts outcome in squamous cell carcinoma of the esophagus.
12435635 p130 turnover is regulated by Cdk-dependent G1 phosphorylation leading to ubiquitin-dependent proteolysis
12386819 p130 and its truncated form might substitute Rb in mediating p53-induced cell cycle arrest in Rb(-/-) Saos2 cells
12196924 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120
12006580 regulation of expression of p130, p107 and E2F-4 in human cells
11642725 may have a role in the mechanisms of proliferation and differentiation during human placental development

AA Sequence

MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDEAARAEAWDSY      1 - 70
RSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKCSEQSLIEFFNKMKKWEDMAN     71 - 140
LPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPRQQRGRKQRRQPCTVSEIFHFCWVLFIY    141 - 210
AKGNFPMISDDLVNSYHLLLCALDLVYGNALQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLC    211 - 280
SLHDGLVLEAKGIKEHFWKPYIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDE    281 - 350
RIFLGEDAEEEIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS    351 - 420
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASK    421 - 490
HFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVP    491 - 560
LYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRVPTCEEVMPPQNLER    561 - 630
ADEICIAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPP    631 - 700
QPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQA    701 - 770
QAVTGSIQPLSAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF    771 - 840
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQ    841 - 910
NIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDRTSRDSSPVMRSSSTLPVPQP    911 - 980
SSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTFAMKYSQANMDAPPLSPYPFVRTGSPRRIQL    981 - 1050
SQNHPVYISPHKNETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPE   1051 - 1120
NHSALLRRLQDVANDRGSH                                                      1121 - 1139
//

Text Mined References (125)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26576645 2015 Hepatitis C virus core protein modulates pRb2/p130 expression in human hepatocellular carcinoma cell lines through promoter methylation.
26271034 2015 Promoter Methylation Status Modulate the Expression of Tumor Suppressor (RbL2/p130) Gene in Breast Cancer.
25183046 2014 TGF-beta induced RBL2 expression in renal cancer cells by down-regulating miR-93.
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
24281253 2014 Silencing of RB1 and RB2/P130 during adipogenesis of bone marrow stromal cells results in dysregulated differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189068 2013 Protein arginine methyltransferase 5 (PRMT5) inhibition induces lymphoma cell death through reactivation of the retinoblastoma tumor suppressor pathway and polycomb repressor complex 2 (PRC2) silencing.
24045973 2013 miR-106a represses the Rb tumor suppressor p130 to regulate cellular proliferation and differentiation in high-grade serous ovarian carcinoma.
23377830 2013 Down-regulation of miR-106b suppresses the growth of human glioma cells.
23370776 2013 Silencing of RB1 but not of RB2/P130 induces cellular senescence and impairs the differentiation potential of human mesenchymal stem cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22595804 2012 A postulated role of p130 in telomere maintenance by human papillomavirus oncoprotein E7.
22002537 2012 Physical and functional interaction between PML and TBX2 in the establishment of cellular senescence.
21813705 2011 Disruption of repressive p130-DREAM complexes by human papillomavirus 16 E6/E7 oncoproteins is required for cell-cycle progression in cervical cancer cells.
21516817 2011 [The cell cycle regulator p130 and beta-catenin form a complex in mesenchymal stem cells].
21511729 2011 p63 maintains keratinocyte proliferative capacity through regulation of Skp2-p130 levels.
21411531 2011 Nonconserved lysine residues attenuate the biological function of the low-risk human papillomavirus E7 protein.
21325284 2011 CTCF and BORIS regulate Rb2/p130 gene transcription: a novel mechanism and a new paradigm for understanding the biology of lung cancer.
21127431 2011 The RB (pRb2/p16) and p53 (p14/p53/p21) tumor-suppressor pathways in endemic Burkitt lymphoma.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20406986 2010 Loss of p130 accelerates tumor development in a mouse model for human small-cell lung carcinoma.
20189212 2010 Low- and high-risk human papillomavirus E7 proteins regulate p130 differently.
20071580 2010 Epigenetic regulation of Kaposi's sarcoma-associated herpesvirus latency by virus-encoded microRNAs that target Rta and the cellular Rbl2-DNMT pathway.
20009087 2010 Genetic variation at the FTO locus influences RBL2 gene expression.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19725879 2009 LIN54 is an essential core subunit of the DREAM/LINC complex that binds to the cdc2 promoter in a sequence-specific manner.
19694314 2009 Lack of Rb2/p130 genetic alteration in Malaysian nasopharyngeal carcinoma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19668264 2009 Senescence and p130/Rbl2: a new beginning to the end.
19648966 2009 Rb2/p130 is the dominating pocket protein in the p53-p21 DNA damage response pathway leading to senescence.
19597825 2009 pRb2/p130 protein in relation to clinicopathological and biological variables in rectal cancers with a clinical trial of preoperative radiotherapy.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19279001 2009 Retinoblastoma/p107/p130 pocket proteins: protein dynamics and interactions with target gene promoters.
19252413 2009 High incidence of allelic loss at 16q12.2 region spanning RBL2/p130 gene in retinoblastoma.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18676747 2008 The retinoblastoma family member pRb2/p130 is an independent predictor of survival in human soft tissue sarcomas.
18446820 2008 Characterization of alterations of Rb2/p130 tumor suppressor in all-trans-retinoic acid resistant SK-OV3 ovarian carcinoma cells.
18418057 2008 Distinct roles for p107 and p130 in Rb-independent cellular senescence.
18321970 2008 Casein kinase II motif-dependent phosphorylation of human papillomavirus E7 protein promotes p130 degradation and S-phase induction in differentiated human keratinocytes.
18086563 2008 Expression of p107 and p130 during human adipose-derived stem cell adipogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17905135 2007 Novel p53/p130 axis in bladder tumors.
17694957 2006 Mutational analysis of p53 and RB2/p130 genes in Malaysian nasopharyngeal carcinoma samples: a preliminary report.
17671431 2007 LINC, a human complex that is related to pRB-containing complexes in invertebrates regulates the expression of G2/M genes.
17620057 2007 Deacetylation of the retinoblastoma tumour suppressor protein by SIRT1.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
17485552 2007 Gene-expression analysis identifies novel RBL2/p130 target genes in endemic Burkitt lymphoma cell lines and primary tumors.
16936755 2006 pRb2/p130: a new candidate for retinoblastoma tumor formation.
16936753 2006 Rb2/p130 and protein phosphatase 2A: key mediators of ovarian carcinoma cell growth suppression by all-trans retinoic acid.
16760287 2006 Nuclear and cytoplasmic interaction of pRb2/p130 and ER-beta in MCF-7 breast cancer cells.
16600870 2006 The Rb-related p130 protein controls telomere lengthening through an interaction with a Rad50-interacting protein, RINT-1.
16537896 2006 Primary and compensatory roles for RB family members at cell cycle gene promoters that are deacetylated and downregulated in doxorubicin-induced senescence of breast cancer cells.
16458891 2006 p205, a potential tumor suppressor, inhibits cell proliferation via multiple pathways of cell cycle regulation.
16364039 2006 Genes associated with telomerase activity levels in esophageal carcinoma cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16286473 2006 The retinoblastoma family proteins bind to and activate diacylglycerol kinase zeta.
16135806 2005 Pocket protein complexes are recruited to distinct targets in quiescent and proliferating cells.
15949438 2005 Binding of pRB to the PHD protein RBP2 promotes cellular differentiation.
15939381 2005 Distinct patterns of expression of the RB gene family in mouse and human retina.
15827088 2005 p130/p107/p105Rb-dependent transcriptional repression during DNA-damage-induced cell-cycle exit at G2.
15696973 2004 Expression of Rb2/p130 protein correlates with the degree of malignancy in gliomas.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467457 2004 A dynamic equilibrium between CDKs and PP2A modulates phosphorylation of pRB, p107 and p130.
15231644 2004 Genotoxic stress induces expression of E2F4, leading to its association with p130 in prostate carcinoma cells.
15161709 2004 pRb2/p130, vascular endothelial growth factor, p27(KIP1), and proliferating cell nuclear antigen expression in hepatocellular carcinoma: their clinical significance.
15131049 2004 Frequent loss of pRb2/p130 in human ovarian carcinoma.
15059924 2004 Overexpression of tumour suppressor retinoblastoma 2 protein (pRb2/p130) in hepatocellular carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671316 2003 Mullerian Inhibiting Substance inhibits cervical cancer cell growth via a pathway involving p130 and p107.
14587097 2003 Reduced transcription of the RB2/p130 gene in human lung cancer.
14534545 2003 pRB2/p130 target genes in non-small lung cancer cells identified by microarray analysis.
13679860 2003 Interaction between HIV-1 Tat and pRb2/p130: a possible mechanism in the pathogenesis of AIDS-related neoplasms.
12968030 2003 SV40 large T antigen promotes dephosphorylation of p130.
12915404 2003 Protein phosphatase 2A associates with Rb2/p130 and mediates retinoic acid-induced growth suppression of ovarian carcinoma cells.
12789260 2003 Triggering of p73-dependent apoptosis in osteosarcoma is under the control of E2Fs-pRb2/p130 complexes.
12789259 2003 pRb2/p130-E2F4/5-HDAC1-SUV39H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 multimolecular complexes mediate the transcription of estrogen receptor-alpha in breast cancer.
12637156 2003 p130 expression in thyroid neoplasms: its linkage with tumor size and dedifferentiation.
12621062 2003 Oxidative stress induces protein phosphatase 2A-dependent dephosphorylation of the pocket proteins pRb, p107, and p130.
12588981 2003 Balance between acetylation and methylation of histone H3 lysine 9 on the E2F-responsive dihydrofolate reductase promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12474056 2002 Clinicopathological significance of pRb2/p130 expression in squamous cell carcinoma of the esophagus.
12466551 2002 Skip interacts with the retinoblastoma tumor suppressor and inhibits its transcriptional repression activity.
12450794 2002 Che-1 affects cell growth by interfering with the recruitment of HDAC1 by Rb.
12435635 2002 The pRb-related protein p130 is regulated by phosphorylation-dependent proteolysis via the protein-ubiquitin ligase SCF(Skp2).
12386819 2002 P130 and its truncated form mediate p53-induced cell cycle arrest in Rb(-/-) Saos2 cells.
12196924 2002 Expression of RB2/p130 tumor-suppressor gene in AIDS-related non-Hodgkin's lymphomas: implications for disease pathogenesis.
12006580 2002 Distinct phosphorylation events regulate p130- and p107-mediated repression of E2F-4.
11959842 2002 E2F mediates cell cycle-dependent transcriptional repression in vivo by recruitment of an HDAC1/mSin3B corepressor complex.
11756542 2002 Nucleocytoplasmic shuttling of p130/RBL2: novel regulatory mechanism.
11642725 2001 Expression of the retinoblastoma-related p107 and Rb2/p130 genes in human placenta: an immunohistochemical study.
11573202 2001 pRb2/p130 and p107 control cell growth by multiple strategies and in association with different compartments within the nucleus.
11319226 2001 Ca2+ and BMP-6 signaling regulate E2F during epidermal keratinocyte differentiation.
11157749 2001 Phosphorylation-dependent and -independent functions of p130 cooperate to evoke a sustained G1 block.
11042701 2000 Phosphorylation of the retinoblastoma-related protein p130 in growth-arrested cells.
11042686 2000 Rb and p130 regulate RNA polymerase I transcription: Rb disrupts the interaction between UBF and SL-1.
11034201 2000 Id2 is a retinoblastoma protein target and mediates signalling by Myc oncoproteins.
10969803 2000 Transforming growth factor-beta1 recruits histone deacetylase 1 to a p130 repressor complex in transgenic mice in vivo.
10449734 1999 A mechanism for Rb/p130-mediated transcription repression involving recruitment of the CtBP corepressor.
10376528 1999 Prohibitin, a potential tumor suppressor, interacts with RB and regulates E2F function.
10330166 1999 RNA polymerase III transcription factor IIIB is a target for repression by pocket proteins p107 and p130.
10022926 1999 Functions of cyclin A1 in the cell cycle and its interactions with transcription factor E2F-1 and the Rb family of proteins.
9819434 1998 Raf-1 physically interacts with Rb and regulates its function: a link between mitogenic signaling and cell cycle regulation.
9747874 1998 Differential expression and functionally co-operative roles for the retinoblastoma family of proteins in epidermal differentiation.
9724731 1998 The three members of the pocket proteins family share the ability to repress E2F activity through recruitment of a histone deacetylase.
9721205 1998 Molecular cloning and characterization of a novel retinoblastoma-binding protein.
9710587 1998 A cellular repressor of E1A-stimulated genes that inhibits activation by E2F.
9697699 1998 A retinoblastoma-binding protein that affects cell-cycle control and confers transforming ability.
9566894 1998 Negative regulation of DNA replication by the retinoblastoma protein is mediated by its association with MCM7.
9464541 1998 Interaction of the pRB-family proteins with factors containing paired-like homeodomains.
9242374 1997 Rb interacts with TAF(II)250/TFIID through multiple domains.
9188854 1997 Identification of a p130 domain mediating interactions with cyclin A/cdk 2 and cyclin E/cdk 2 complexes.
9178770 1997 The HMG-box transcription factor HBP1 is targeted by the pocket proteins and E1A.
8643454 1996 Genomic structure of the human retinoblastoma-related Rb2/p130 gene.
8361765 1993 Cloning of a new member of the retinoblastoma gene family (pRb2) which binds to the E1A transforming domain.
8253384 1993 Isolation of the Rb-related p130 through its interaction with CDK2 and cyclins.
8253383 1993 The adenovirus E1A-associated 130-kD protein is encoded by a member of the retinoblastoma gene family and physically interacts with cyclins A and E.
8247552 1993 The retinoblastoma-related gene, RB2, maps to human chromosome 16q12 and rat chromosome 19.
7760804 1995 E2F-5, a new E2F family member that interacts with p130 in vivo.
1331501 1992 Homologous sequences in adenovirus E1A and human papillomavirus E7 proteins mediate interaction with the same set of cellular proteins.