Property Summary

NCBI Gene PubMed Count 36
PubMed Score 61.36
PubTator Score 113.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
posterior fossa group B ependymoma -2.000 1.1e-11
esophageal adenocarcinoma -1.100 2.1e-02
osteosarcoma 4.397 7.7e-10
glioblastoma -1.800 1.3e-06
atypical teratoid / rhabdoid tumor -1.400 5.4e-04
primary pancreatic ductal adenocarcinoma 1.323 3.9e-02
colon cancer -1.700 8.7e-04
pediatric high grade glioma -1.500 1.9e-07
group 4 medulloblastoma 1.200 4.5e-02
pilocytic astrocytoma -1.400 1.4e-05
subependymal giant cell astrocytoma -2.500 2.0e-02
spina bifida -1.665 2.9e-02
invasive ductal carcinoma -1.100 1.0e-02
ovarian cancer 2.900 1.9e-08
pancreatic cancer 1.300 4.2e-02
dermatomyositis -1.400 1.6e-04

Gene RIF (18)

PMID Text
25921069 CPSF2 and SYMPK, are RBFOX2 cofactors for both inclusion and exclusion of internal exons.
25524026 RBFOX proteins can facilitate the splicing of micro-exons. We also found that PTBP1 likely regulates the inclusion of micro-exons, possibly by repressing the inclusion of micro-exons that are enhanced by RBFOX proteins and other splicing factors.[RBFOX]
25087874 Results show that the conserved Rbfox2 RNA binding protein regulates 30% of the splicing transitions observed during myogenesis and is required for the specific step of myoblast fusion.
25065397 RBFOX2 SNPs showed evidence for effects across multiple reading and language traits.
24048253 MBNL1 and RBFOX2 cooperate to establish a splicing programme involved in pluripotent stem cell differentiation.
23149937 RBFOX2 drives mesenchymal tissue-specific splicing in both normal and cancer tissues.
23143756 RBFOX2 polymorphism is associated with breast cancer.
22666429 FOX-2 is involved in splicing of ataxin-2 transcripts and that this splicing event is altered by overexpression of ataxin-1
22083953 This study characterizes the mechanism by which RBFOX2 regulates protein 4.1R exon 16 splicing through the downstream intronic element UGCAUG.
21876675 functional significance of EMT-associated alternative splicing depletion of RBFOX2 in mesenchymal cells
21747913 the negative regulation of Rbfox2 by Rbfox3 through a novel mechanism
20131247 Fox-2 plays an integral role in the regulation of LH2 splicing and knockdown of Fox-2 may suggest a novel approach to strategies directed against scleroderma.
19136955 These findings suggest that FOX2 functions as a critical regulator of a splicing network, and that FOX2 is important for the survival of human embryonic stem cells.
18794351 predict thousands of Fox-1/2 targets with conserved binding sites, at a false discovery rate of approximately 24%, including many validated experimentally, suggesting a surprisingly extensive splicing regulatory networks
18573884 These results establish hnRNP H and hnRNP F as being repressors of exon inclusion and suggest that Fox proteins enhance their ability to antagonize ASF/SF2.
18573872 Fox-1/Fox-2 proteins block prespliceosome complex formation at two distinct steps through binding to two functionally important UGCAUG elements.
16537540 Fox-1 and Fox-2 splicing factors have roles in alternative splicing of protein 4.1R
16260614 Fox-1 and Fox-2 isoforms specifically activate splicing of neuronally regulated exons, which requires UGCAUG enhancer elements

AA Sequence

MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLT      1 - 70
LYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQM     71 - 140
FGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYA    141 - 210
NGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAF    211 - 280
RGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYS    281 - 350
DGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY                                  351 - 390
//

Text Mined References (39)

PMID Year Title
25921069 2015 Global Promotion of Alternative Internal Exon Usage by mRNA 3' End Formation Factors.
25524026 2015 RBFOX and PTBP1 proteins regulate the alternative splicing of micro-exons in human brain transcripts.
25416956 2014 A proteome-scale map of the human interactome network.
25087874 2014 Rbfox2-coordinated alternative splicing of Mef2d and Rock2 controls myoblast fusion during myogenesis.
25065397 2014 Genome-wide screening for DNA variants associated with reading and language traits.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24048253 2013 MBNL1 and RBFOX2 cooperate to establish a splicing programme involved in pluripotent stem cell differentiation.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23149937 2013 RBFOX2 is an important regulator of mesenchymal tissue-specific splicing in both normal and cancer tissues.
23143756 2013 Associations of polymorphisms in the genes of FGFR2, FGF1, and RBFOX2 with breast cancer risk by estrogen/progesterone receptor status.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22666429 2012 FOX-2 dependent splicing of ataxin-2 transcript is affected by ataxin-1 overexpression.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22083953 2012 RBFOX2 promotes protein 4.1R exon 16 selection via U1 snRNP recruitment.
21876675 2011 An EMT-driven alternative splicing program occurs in human breast cancer and modulates cellular phenotype.
21747913 2011 NeuN/Rbfox3 nuclear and cytoplasmic isoforms differentially regulate alternative splicing and nonsense-mediated decay of Rbfox2.
21269460 2011 Initial characterization of the human central proteome.
20131247 2010 Fox-2 protein regulates the alternative splicing of scleroderma-associated lysyl hydroxylase 2 messenger RNA.
19136955 2009 An RNA code for the FOX2 splicing regulator revealed by mapping RNA-protein interactions in stem cells.
18794351 2008 Defining the regulatory network of the tissue-specific splicing factors Fox-1 and Fox-2.
18573884 2008 hnRNP H and hnRNP F complex with Fox2 to silence fibroblast growth factor receptor 2 exon IIIc.
18573872 2008 Repression of prespliceosome complex formation at two distinct steps by Fox-1/Fox-2 proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17715393 2008 Regulated Fox-2 isoform expression mediates protein 4.1R splicing during erythroid differentiation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16537540 2006 Fox-2 splicing factor binds to a conserved intron motif to promote inclusion of protein 4.1R alternative exon 16.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260614 2005 Homologues of the Caenorhabditis elegans Fox-1 protein are neuronal splicing regulators in mammals.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875103 2002 A negative coregulator for the human ER.
11401487 2001 Androgens regulate the mammalian homologues of invertebrate sex determination genes tra-2 and fox-1.
10591208 1999 The DNA sequence of human chromosome 22.