Property Summary

NCBI Gene PubMed Count 47
PubMed Score 36.89
PubTator Score 31.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.003 3.3e-03
Multiple myeloma 1.409 1.3e-04
osteosarcoma -1.111 5.1e-04
glioblastoma 1.200 7.2e-03
juvenile dermatomyositis 1.217 4.7e-12
tuberculosis 1.400 2.0e-07
group 3 medulloblastoma 1.100 4.6e-04
posterior fossa group A ependymoma 1.100 4.3e-07
ovarian cancer 1.100 5.1e-03
dermatomyositis 1.200 7.4e-03

 GO Component (2)

Gene RIF (20)

PMID Text
26525107 Late in the NF-kappaB activation cycle HOIL1 cleavage transiently reduces linear ubiquitination, including of NEMO and RIP1, dampening NF-kappaB activation and preventing reactivation.
26008899 human HOIP is essential for the assembly and function of LUBAC, which includes HOIL-1, and for various processes governing inflammation and immunity in both hematopoietic and nonhematopoietic cells
23912458 findings support a role for RBCK1 in the regulation of FKBPL with important implications for estrogen receptor signaling, cell proliferation and response to endocrine therapy.
23798481 RBCK1 deficiency is a frequent cause of polyglucosan storage myopathy associated with progressive muscle weakness and cardiomyopathy.
23160820 Suggest that RBCK1 is important for the ubiquitination of PXR and may play a role in its proteasomal degradation.
23104095 Patients from two kindreds of a new fatal inherited disorder characterized by chronic autoinflammation, invasive bacterial infections and muscular amylopectinosis carried biallelic loss-of-expression and loss-of-function mutations in HOIL1.
23042805 Estrogen receptor-alpha, RBCK1, and protein kinase C beta 1 cooperate to regulate estrogen receptor-alpha gene expression.
22517668 The solution structure of the HOIL1 Ubl domain was solved using NMR spectroscopy to compare it with that of parkin to determine the structural elements responsible for S5a subunit of the 26S proteasome intermolecular interactions.
22139374 analysis of recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
20956555 Data report the identification of the related proteins Sipl1 (Shank-interacting protein-like 1) and Rbck1 (RBCC protein interacting with PKC1) as novel interaction partners of Eya1.
20103625 Findings suggest that RBCK1 regulates cell cycle progression and proliferation of ERalpha-positive breast cancer cells by supporting transcription of ERalpha and cyclin B1.
19796170 RBCK2 functions as an adaptor protein for the polyubiquitinated protein and the S5a subunit in 26S proteasome through its novel zinc finger motif and ubiquitin-like domain, respectively.
19277210 The shRNA barcode screening technique identified RBCK1 as being involved in p53 regulation.
18711448 Study shows that the E3 ubiquitin ligase RBCC protein interacting with PKC1 (RBCK1) catalyzes the ubiquitination and degradation of IRF3.
18303026 the E3 activity of RBCK1 is controlled by two distinct manners, interaction with RBCK2 and phosphorylation by PKCbeta
17822790 These data demonstrate that HOIL-1 is not required for iron-dependent degradation of IRP2 in HEK293 cells, and suggest that a HOIL-1 independent mechanism is used for IRP2 degradation in most cell types.
17449468 findings suggest that RBCK1 is involved in negative regulation of inflammatory signaling triggered by TNF and IL-1 through targeting TAB2/3 for degradation
16643902 HOIL-1 expression stabilizes SOCS6 and induces the ubiquitination and degradation of proteins associated with SOCS6
16083853 RBCK2 serves as a cytoplasmic tethering protein for RBCK1
15833741 RBCK1 (human C20orf18 and rat Pkcbpb15) is involved in transcriptional machinery in the nuclear bodies, and its transcriptional activity is regulated by nucleocytoplasmic shuttling.

AA Sequence

MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVT      1 - 70
IWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNP     71 - 140
QELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTR    141 - 210
PGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPA    211 - 280
ECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDY    281 - 350
QRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLAL    351 - 420
RAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTS    421 - 490
GGCRCRVNGIPCHPSCQNCH                                                      491 - 510
//

Text Mined References (50)

PMID Year Title
27523608 2016 The Deubiquitinase OTULIN Is an Essential Negative Regulator of Inflammation and Autoimmunity.
26525107 2015 The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-?B signalling.
26008899 2015 Human HOIP and LUBAC deficiency underlies autoinflammation, immunodeficiency, amylopectinosis, and lymphangiectasia.
25416956 2014 A proteome-scale map of the human interactome network.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
24726323 2014 Molecular basis and regulation of OTULIN-LUBAC interaction.
23912458 2014 Identification of RBCK1 as a novel regulator of FKBPL: implications for tumor growth and response to tamoxifen.
23798481 2013 Polyglucosan body myopathy caused by defective ubiquitin ligase RBCK1.
23453807 2013 The E3 ligase parkin maintains mitochondrial integrity by increasing linear ubiquitination of NEMO.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160820 2013 RBCK1, an E3 ubiquitin ligase, interacts with and ubiquinates the human pregnane X receptor.
23104095 2012 Immunodeficiency, autoinflammation and amylopectinosis in humans with inherited HOIL-1 and LUBAC deficiency.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
23042805 2012 Estrogen receptor-?, RBCK1, and protein kinase C ? 1 cooperate to regulate estrogen receptor-? gene expression.
23032186 2012 A20 inhibits LUBAC-mediated NF-?B activation by binding linear polyubiquitin chains via its zinc finger 7.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22791023 2012 LUBAC synthesizes linear ubiquitin chains via a thioester intermediate.
22517668 2012 Solution structure of the E3 ligase HOIL-1 Ubl domain.
22430200 2012 A non-canonical UBA-UBL interaction forms the linear-ubiquitin-chain assembly complex.
22139374 2011 Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21811235 2011 LUBAC regulates NF-?B activation upon genotoxic stress by promoting linear ubiquitination of NEMO.
21455181 2011 SHARPIN forms a linear ubiquitin ligase complex regulating NF-?B activity and apoptosis.
21455180 2011 SHARPIN is a component of the NF-?B-activating linear ubiquitin chain assembly complex.
21455173 2011 Linear ubiquitination prevents inflammation and regulates immune signalling.
20956555 2010 Sipl1 and Rbck1 are novel Eya1-binding proteins with a role in craniofacial development.
20103625 2010 RBCK1 drives breast cancer cell proliferation by promoting transcription of estrogen receptor alpha and cyclin B1.
20098747 2010 Expanding the substantial interactome of NEMO using protein microarrays.
20005846 2009 Recruitment of the linear ubiquitin chain assembly complex stabilizes the TNF-R1 signaling complex and is required for TNF-mediated gene induction.
19796170 2009 Accumulation of polyubiquitinated proteins by overexpression of RBCC protein interacting with protein kinase C2, a splice variant of ubiquitin ligase RBCC protein interacting with protein kinase C1.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19277210 2009 A large scale shRNA barcode screen identifies the circadian clock component ARNTL as putative regulator of the p53 tumor suppressor pathway.
19136968 2009 Involvement of linear polyubiquitylation of NEMO in NF-kappaB activation.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18711448 2008 Negative feedback regulation of cellular antiviral signaling by RBCK1-mediated degradation of IRF3.
18303026 2008 Identification of ubiquitin ligase activity of RBCK1 and its inhibition by splice variant RBCK2 and protein kinase Cbeta.
17822790 2008 HOIL-1 is not required for iron-mediated IRP2 degradation in HEK293 cells.
17449468 2007 RBCK1 negatively regulates tumor necrosis factor- and interleukin-1-triggered NF-kappaB activation by targeting TAB2/3 for degradation.
17006537 2006 A ubiquitin ligase complex assembles linear polyubiquitin chains.
16643902 2006 The E3 ubiquitin ligase HOIL-1 induces the polyubiquitination and degradation of SOCS6 associated proteins.
16083853 2005 Cytoplasmic tethering of a RING protein RBCK1 by its splice variant lacking the RING domain.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15833741 2005 Nuclear-cytoplasmic shuttling of a RING-IBR protein RBCK1 and its functional interaction with nuclear body proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
12629548 2003 Identification of the ubiquitin-protein ligase that recognizes oxidized IRP2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10431818 1999 A family of structurally related RING finger proteins interacts specifically with the ubiquitin-conjugating enzyme UbcM4.
9195957 1997 The hepatitis B virus X-associated protein, XAP3, is a protein kinase C-binding protein.