Property Summary

NCBI Gene PubMed Count 91
PubMed Score 142.23
PubTator Score 108.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.100 3.9e-16
glioblastoma 1.900 1.5e-03
oligodendroglioma 1.200 4.9e-11
posterior fossa group A ependymoma 1.500 1.2e-08
sonic hedgehog group medulloblastoma 1.600 3.2e-05
atypical teratoid / rhabdoid tumor 1.800 3.7e-05
medulloblastoma, large-cell 1.500 6.4e-06
primitive neuroectodermal tumor 1.200 1.6e-04
colon cancer 2.600 5.9e-03
lung cancer 3.100 7.6e-05
pediatric high grade glioma 1.500 1.5e-05
subependymal giant cell astrocytoma 2.028 1.7e-02
nasopharyngeal carcinoma 1.300 1.7e-04
inflammatory breast cancer -1.500 3.8e-03
lung carcinoma 1.100 1.7e-15
ovarian cancer 1.600 2.0e-04
pituitary cancer -1.200 4.5e-04

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
651724 screening 1654 / 5502 / 328376 qHTS Assay for Inhibitors of the CtBP/E1A Interaction
651737 summary 0 / 0 / 0 qHTS Assay for Inhibitors of the CtBP/E1A Interaction

Gene RIF (56)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
26387952 USP4 cooperates with CtIP in DNA double-strand break end resection.
26333564 Homozygous RBBP8 mutation is associated with microcephaly, intellectual disability, short stature and brachydactyly.
25957490 CtIP is a DNA damage response protein at the intersection of DNA metabolism. (Review)
25909997 BRCA1 and CtIP contribute to DSB resection by recruiting Dna2 to damage sites, thus ensuring the robust DSB resection necessary for efficient homologous recombination.
25771978 findings provide strong evidence that CtIP is continuously recruited to DSBs downstream of both the initiation and extension step of resection
25349192 CtIP interacts with Cdh1 through a conserved KEN box, mutation of which impedes ubiquitylation and downregulation of CtIP both during G1 and after DNA damage in G2.
25308476 The CtIP 3'UTR is directly targeted by miR-19a and miR-19b.
25267294 Plk3 binds to CtIP phosphorylated at S327 via its Polo box domains, which is necessary for robust damage-induced CtIP phosphorylation at S327 and subsequent CtIP phosphorylation at T847.
25053769 Possible association of SOX-17 and RBBP8 with brain arteriovenous malformations, genes involved in cell cycle progression, deserves further investigation
24837676 human CtIP is a 5' flap endonuclease and this activity is required in some contexts for the efficient function of CtIP.
24837675 These studies suggest that an end resection-independent CtIP function is important for processing double-strand break ends with secondary structures to promote homologous recombination.
24794434 Data indicate that FANCD2 primes CtIP-dependent resection during HR after ICL induction but that CtIP helps prevent illegitimate recombination in FA cells.
24556218 Study identified CtIP as a novel interaction partner of FANCD2. CtIP binds and stabilizes FANCD2 in a DNA damage- and FA core complex-independent manner, suggesting that FANCD2 monoubiquitination is dispensable for its interaction with CtIP.
24440292 study identified a homozygous mutation in RBBP8, which co-segregates with microcephaly-associated intellectual disability syndrome in a Pakistani family; also identified a heterozygous deletion encompassing the NRXN1 in this family, which is present in 2 affected sibs with complex phenotype and the mother with mild phenotype
24403251 Low or no expression of RBBP8 correlates with high-grade breast cancer, poor prognosis and with nodal metastasis.
24196441 our data demonstrate that CtIP is required for DNA damage-induced P21 induction
23994874 BRCA1/CtIP-mediated processing of the second end of the break controls the annealing step that normally terminates synthesis-dependent strand annealing, thereby suppressing the error-prone long-tract gene conversion outcome.
23696749 Taken together, these findings strongly suggest that an ATM-dependent CREB-miR-335-CtIP axis influences the selection of HRR for repair of certain DSB lesions
23468639 These studies reveal one important mechanism to regulate cell-cycle-dependent activation of HR upon DNA damage by coupling CDK- and ATM-mediated phosphorylation of CtIP through modulating the interaction of CtIP with Nbs1
23353824 Data suggest that overexpression of LMO4 may disrupt some of the normal tumour suppressor activities of CtIP, thereby contributing to breast cancer progression.
23349304 Microsatellite instability dependent mutations were detected in CtIP in myeloid malignancies conferring hypersensitivity to PARP inhibitors.
23333306 RIF1 accumulation at DSB sites is strongly antagonized by BRCA1 and its interacting partner CtIP
22832221 CtIP binds to ATM protein proximal promoter, but after DNA damage Ctip is released.
22733999 show that CHK1 was rapidly and robustly activated before detectable end resection
22544744 The severe repair defects of CtIP dimerization mutants are likely due to the failure in localization to chromosomal DSBs upon DNA damage.
22231403 The authors show that, in human and mouse, Mre11 controls these events through a direct interaction with CDK2 that is required for CtIP phosphorylation and BRCA1 interaction in normally dividing cells.
21998596 the SCKL2 mutation creates an alternative splicing site leading to both the normal and aberrant CtIP proteins coexisting in the cells of patients and carriers
21052091 This study identifies new functions of CtIP and EXO1 in DNA end resection and provides new information on the regulation of DNA double-strand breaks repair pathways, which is a key factor in the maintenance of genome integrity.
20975951 Studies indicate that codon-based models of gene evolution yielded statistical support for the recurrent positive selection of five NHEJ genes during primate evolution: XRCC4, NBS1, Artemis, POLlambda, and CtIP.
20974687 BCR-ABL promotes mutagenic DSB repair with the DSB end-processing protein CtIP acting as the key mediator downstream of BCR-ABL
20829486 identified double-strand break(DSB) resection protein CtIP as a SIRT6 interaction partner; showed SIRT6-dependent CtIP deacetylation promotes resection;CtIP identified as key substrate by which SIRT6 facilitates DSB processing and homologous recombination
20635389 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20064462 CtIP facilitates the transition from DSB sensing to processing, by binding to the DNA at double-strand breaks (DSBs) after DSB sensing and ATM activation and then promoting DNA resection, leading to checkpoint activation and homologous recombination.
20007691 Data found that HMGA2, along with a dozen of other genes, was co-repressed by ZBRK1, BRCA1, and CtIP.
19690177 Observational study of gene-disease association. (HuGE Navigator)
19633668 Data show that silencing of Rad50 or CtIP decreases end-joining efficiency in the same pathway as Mre11.
19584272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19357644 CtIP is required not only for repair of double strand breaks by homologous recombination in S/G2 phase but also for microhomology-mediated end-joining in G1
19342888 CtIP is recruited to S-phase DNA replication foci through a novel motif functioning as replication foci targeting sequence.
19270026 Single nucleotide polymorphisms in CASP5 and RBBP8 gene are associated with survival in ovarian cancer patients.
19270026 Observational study of gene-disease association. (HuGE Navigator)
19202191 unlike cells expressing wild-type CtIP, cells expressing the Thr-to-Glu mutant resect DSBs even after cyclin-dependent kinase inhibition
18950845 Observational study of gene-disease association. (HuGE Navigator)
18676825 Stresses and stimuli that reduce CtBP-mediated repression are associated with increased p16 expression; therefore, CtBP may provide a common final target for regulating the balance among tumor suppression, regenerative capacity, and senescence
18171986 CtIP silencing might be a novel mechanism for the development of tamoxifen resistance in breast cancer, suggesting that CtIP is likely associated with estrogen receptor function
18171670 cell cycle-dependent complex formation of BRCA1, CtIP, and MRN contributes to the activation of HR-mediated DSB repair in the S and G(2) phases of the cell cycle.
18095152 the BRCA1 interacting protein CTIP has a role in breast cancer
18007598 Results idientify COM1, a novel plant gene essential for meiosis that is related to the human CtIP and the yeast COM1/SAE2 gene.
17965729 findings establish evolutionarily conserved roles for CtIP-like proteins in controlling DSB resection, checkpoint signalling and homologous recombination
17546052 Data show that CtIP expression is induced by AdE1A during viral infection and that reduction of CtIP expression with RNA interference can retard virus replication.
17112672 Since CtIP plays important roles in cell cycle checkpoint control and it has been implicated in tumorigenesis, our data suggest that TRB3 may be involved in these biological processes through interacting with CtIP.
16581787 CTIP activates its own and cyclin D promoters via the E2F/RB pathway during G1/S progression.
16287852 a corepressor complex containing CtIP/CtBP facilitates RBP-Jkappa/SHARP-mediated repression of Notch target genes
11751867 These findings reveal a novel complex between BRCA1, LMO4, and CtIP and indicate a role for LMO4 as a repressor of BRCA1 activity in breast tissue.

AA Sequence

MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFFTKNQQLREQQ      1 - 70
KVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQ     71 - 140
KIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCANEMRKVSKSS    141 - 210
THPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGD    211 - 280
ELYHCLEGNHKKQPFEESTRNTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSL    281 - 350
LQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQN    351 - 420
RTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKP    421 - 490
LDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECII    491 - 560
LQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVLDDIKSAGSHEPIKIQTRSDHGGCELASVLQ    561 - 630
LNPCRTGKIKSLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVL    631 - 700
LKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDK    701 - 770
VKQKAFVEPYFKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRF    771 - 840
RYIPPNTPENFWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT                 841 - 897
//

Text Mined References (104)

PMID Year Title
27561354 2016 Cullin3-KLHL15 ubiquitin ligase mediates CtIP protein turnover to fine-tune DNA-end resection.
26807646 2016 EXD2 promotes homologous recombination by facilitating DNA end resection.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
26387952 2015 The Deubiquitylating Enzyme USP4 Cooperates with CtIP in DNA Double-Strand Break End Resection.
26333564 2015 RBBP8 syndrome with microcephaly, intellectual disability, short stature and brachydactyly.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25957490 2015 CtIP: A DNA damage response protein at the intersection of DNA metabolism.
25909997 2015 BRCA1 and CtIP Are Both Required to Recruit Dna2 at Double-Strand Breaks in Homologous Recombination.
25771978 2015 Novel characteristics of CtIP at damage-induced foci following the initiation of DNA end resection.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
25349192 2014 APC/C(Cdh1) controls CtIP stability during the cell cycle and in response to DNA damage.
25308476 2015 miR-19, a component of the oncogenic miR-17?92 cluster, targets the DNA-end resection factor CtIP.
25267294 2014 Polo-like kinase 3 regulates CtIP during DNA double-strand break repair in G1.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25053769 2015 Evaluation of genetic risk loci for intracranial aneurysms in sporadic arteriovenous malformations of the brain.
24837676 2014 Catalytic and noncatalytic roles of the CtIP endonuclease in double-strand break end resection.
24837675 2014 CtIP maintains stability at common fragile sites and inverted repeats by end resection-independent endonuclease activity.
24794434 2014 FANCD2 and CtIP cooperate to repair DNA interstrand crosslinks.
24556218 2014 CtIP mediates replication fork recovery in a FANCD2-regulated manner.
24440292 2014 A complex microcephaly syndrome in a Pakistani family associated with a novel missense mutation in RBBP8 and a heterozygous deletion in NRXN1.
24403251 2013 Prognostic value of CtIP/RBBP8 expression in breast cancer.
24389050 2014 Genomic analysis of primordial dwarfism reveals novel disease genes.
24196441 2014 CtIP is required for DNA damage-dependent induction of P21.
23994874 2013 BRCA1 and CtIP suppress long-tract gene conversion between sister chromatids.
23696749 2013 ATM-dependent MiR-335 targets CtIP and modulates the DNA damage response.
23468639 2013 The interaction of CtIP and Nbs1 connects CDK and ATM to regulate HR-mediated double-strand break repair.
23353824 2013 Structural basis of the interaction of the breast cancer oncogene LMO4 with the tumour suppressor CtIP/RBBP8.
23349304 2013 Microsatellite instability induced mutations in DNA repair genes CtIP and MRE11 confer hypersensitivity to poly (ADP-ribose) polymerase inhibitors in myeloid malignancies.
23333306 2013 A cell cycle-dependent regulatory circuit composed of 53BP1-RIF1 and BRCA1-CtIP controls DNA repair pathway choice.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144634 2012 CtIP is required to initiate replication-dependent interstrand crosslink repair.
22832221 2012 Dynamic coregulatory complex containing BRCA1, E2F1 and CtIP controls ATM transcription.
22733999 2012 CtIP-dependent DNA resection is required for DNA damage checkpoint maintenance but not initiation.
22544744 2012 CtIP protein dimerization is critical for its recruitment to chromosomal DNA double-stranded breaks.
22231403 2012 Mre11 regulates CtIP-dependent double-strand break repair by interaction with CDK2.
21998596 2011 CtIP Mutations Cause Seckel and Jawad Syndromes.
21799032 2011 Modification of BRCA1-Associated Breast and Ovarian Cancer Risk by BRCA1-Interacting Genes.
21052091 2010 DNA end resection by CtIP and exonuclease 1 prevents genomic instability.
20975951 2010 Ancient and recent adaptive evolution of primate non-homologous end joining genes.
20974687 2011 BCR-ABL stimulates mutagenic homologous DNA double-strand break repair via the DNA-end-processing factor CtIP.
20829486 2010 Human SIRT6 promotes DNA end resection through CtIP deacetylation.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
20635389 2011 Common alleles in candidate susceptibility genes associated with risk and development of epithelial ovarian cancer.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20364137 2010 Genome-wide association study of intracranial aneurysm identifies three new risk loci.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20064462 2009 CtIP links DNA double-strand break sensing to resection.
20007691 2010 Derepression of HMGA2 via removal of ZBRK1/BRCA1/CtIP complex enhances mammary tumorigenesis.
19759395 2009 N terminus of CtIP is critical for homologous recombination-mediated double-strand break repair.
19702191 2007 Against doctor's orders: the force and limits of personal autonomy in the health care setting.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19633668 2009 Role of Mre11 in chromosomal nonhomologous end joining in mammalian cells.
19584272 2009 Modification of ovarian cancer risk by BRCA1/2-interacting genes in a multicenter cohort of BRCA1/2 mutation carriers.
19357644 2009 CtIP-BRCA1 modulates the choice of DNA double-strand-break repair pathway throughout the cell cycle.
19342888 2009 Expression of PCNA-binding domain of CtIP, a motif required for CtIP localization at DNA replication foci, causes DNA damage and activation of DNA damage checkpoint.
19270026 2009 Functional complementation studies identify candidate genes and common genetic variants associated with ovarian cancer survival.
19202191 2009 Human CtIP mediates cell cycle control of DNA end resection and double strand break repair.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18716619 2008 CDK targets Sae2 to control DNA-end resection and homologous recombination.
18676825 2008 COOH-terminal binding protein regulates expression of the p16INK4A tumor suppressor and senescence in primary human cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18171986 2007 CtIP silencing as a novel mechanism of tamoxifen resistance in breast cancer.
18171670 2008 Cell cycle-dependent complex formation of BRCA1.CtIP.MRN is important for DNA double-strand break repair.
18095152 2008 Breast cancer risk and the BRCA1 interacting protein CTIP.
18007598 2007 A novel plant gene essential for meiosis is related to the human CtIP and the yeast COM1/SAE2 gene.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17965729 2007 Human CtIP promotes DNA end resection.
17546052 2007 C-terminal-binding protein interacting protein binds directly to adenovirus early region 1A through its N-terminal region and conserved region 3.
17525340 2007 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response.
17112672 2007 TRB3 interacts with CtIP and is overexpressed in certain cancers.
16818604 2006 BRCA1 ubiquitinates its phosphorylation-dependent binding partner CtIP.
16581787 2006 CtIP activates its own and cyclin D1 promoters via the E2F/RB pathway during G1/S progression.
16287852 2005 RBP-Jkappa/SHARP recruits CtIP/CtBP corepressors to silence Notch target genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485915 2004 DNA damage-induced cell cycle checkpoint control requires CtIP, a phosphorylation-dependent binding partner of BRCA1 C-terminal domains.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15084581 2004 Dimerization of CtIP, a BRCA1- and CtBP-interacting protein, is mediated by an N-terminal coiled-coil motif.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654780 2003 SIAH-1 interacts with CtIP and promotes its degradation by the proteasome pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12015313 2002 A molecular dissection of the repression circuitry of Ikaros.
11959865 2002 Ikaros-CtIP interactions do not require C-terminal binding protein and participate in a deacetylase-independent mode of repression.
11781686 2001 A new locus for Seckel syndrome on chromosome 18p11.31-q11.2.
11751867 2002 The LIM domain protein LMO4 interacts with the cofactor CtIP and the tumor suppressor BRCA1 and inhibits BRCA1 activity.
11739404 2001 BRCA1-induced large-scale chromatin unfolding and allele-specific effects of cancer-predisposing mutations.
11689934 2001 Effect of DNA damage on a BRCA1 complex.
11427533 2001 TGIF2 interacts with histone deacetylase 1 and represses transcription.
11313276 2001 The corepressor CtBP interacts with Evi-1 to repress transforming growth factor beta signaling.
10918303 2000 Roles of BRCA1 and its interacting proteins.
10910365 2000 Functional link of BRCA1 and ataxia telangiectasia gene product in DNA damage response.
10783144 2000 Identification of a novel partner of RNA polymerase II subunit 11, Che-1, which interacts with and affects the growth suppression function of Rb.
10764811 2000 Nuclear localization and cell cycle-specific expression of CtIP, a protein that associates with the BRCA1 tumor suppressor.
10449734 1999 A mechanism for Rb/p130-mediated transcription repression involving recruitment of the CtBP corepressor.
10196224 1999 Binding of CtIP to the BRCT repeats of BRCA1 involved in the transcription regulation of p21 is disrupted upon DNA damage.
9811458 1998 Characterization of a carboxy-terminal BRCA1 interacting protein.
9738006 1998 The C-terminal (BRCT) domains of BRCA1 interact in vivo with CtIP, a protein implicated in the CtBP pathway of transcriptional repression.
9721205 1998 Molecular cloning and characterization of a novel retinoblastoma-binding protein.
9535825 1998 Interaction between a cellular protein that binds to the C-terminal region of adenovirus E1A (CtBP) and a novel cellular protein is disrupted by E1A through a conserved PLDLS motif.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.