Property Summary

NCBI Gene PubMed Count 56
PubMed Score 32.63
PubTator Score 33.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.010 4.1e-04
acute quadriplegic myopathy 1.046 5.1e-05
ovarian cancer -1.400 4.3e-04

Gene RIF (13)

PMID Text
25885317 Ras induced RbAp46 expression increases invasion of bladder cancer cells.
25795299 the CRL4 complex containing RBBP7 (CRL4(RBBP7)) might regulate mitosis by promoting ubiquitin-dependent loading of newly synthesized CENP-A during the G1 phase of the cell cycle.
24116224 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
22190034 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19655816 Both of RbAp46 mRNA and protein levels were upregulated significantly in NSCLC cancer tissues. Serum levels of RbAp46 were markedly higher in NSCLC patients than in healthy controls.
19454010 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
18577416 Data show that RbAp46 and RbAp48 interact with estrogen receptor (ER)alpha at endogenous, estrogen-responsive genes and alter expression of endogenous, ERalpha-activated and -repressed genes in MCF-7 breast cancer cells.
18571423 RbAp46 folds into a seven-bladed beta propeller structure and binds histone H4 in a groove formed between an N-terminal alpha helix and an extended loop inserted into blade six.
17314274 RT-PCR data show high expression of putative tumor suppressor genes Rsk4 and RbAp46 in 47% and 79% of breast carcinoma cases, respectively, whereas Cldn2 was down-regulated in 52% of breast cancer cases compared with normal adjacent tissues.
14981905 RbAp46 inhibits cell growth and suppresses the transformed phenotypes of tumor cell lines.
14666671 RbAp46 expression suppresses the transformed phenotypes of breast cancer cells, and dysregulation of RbAp46 expression may contribute to breast cancer tumorigenesis.

AA Sequence

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTH      1 - 70
TSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIA     71 - 140
TKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGP    141 - 210
KEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF    211 - 280
NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG    281 - 350
EEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL    351 - 420
EGQGS                                                                     421 - 425
//

Text Mined References (69)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25885317 2015 Ras induces experimental lung metastasis through up-regulation of RbAp46 to suppress RECK promoter activity.
25795299 2015 CRL4(RBBP7) is required for efficient CENP-A deposition at centromeres.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25556658 2015 Dynamic phosphorylation of CENP-A at Ser68 orchestrates its cell-cycle-dependent deposition at centromeres.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23273982 2013 An H3K36 methylation-engaging Tudor motif of polycomb-like proteins mediates PRC2 complex targeting.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23104054 2012 Phf19 links methylated Lys36 of histone H3 to regulation of Polycomb activity.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20075857 2010 JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19862764 2009 Analysis of interaction partners of H4 histone by a new proteomics approach.
19703393 2009 LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer.
19655816 2009 Discovery of retinoblastoma-associated binding protein 46 as a novel prognostic marker for distant metastasis in nonsmall cell lung cancer by combined analysis of cancer cell secretome and pleural effusion proteome.
19644445 2009 ZIP: a novel transcription repressor, represses EGFR oncogene and suppresses breast carcinogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19497860 2009 LSD1-mediated epigenetic modification is required for TAL1 function and hematopoiesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18577416 2008 The role of retinoblastoma-associated proteins 46 and 48 in estrogen receptor alpha mediated gene expression.
18571423 2008 Structural basis for the recognition of histone H4 by the histone-chaperone RbAp46.
17314274 2007 Aberrant expression of X-linked genes RbAp46, Rsk4, and Cldn2 in breast cancer.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15635413 2005 Nucleolar proteome dynamics.
15456747 2004 MBD3L1 is a transcriptional repressor that interacts with methyl-CpG-binding protein 2 (MBD2) and components of the NuRD complex.
15451426 2004 Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15016378 2004 APPL proteins link Rab5 to nuclear signal transduction via an endosomal compartment.
14981905 Inducible expression of RbAp46 activates c-Jun NH2-terminal kinase-dependent apoptosis and suppresses progressive growth of tumor xenografts in nude mice.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14666671 Constitutive expression of Rb associated protein 46 (RbAp46) reverts transformed phenotypes of breast cancer cells.
14645126 2004 Atrophin 2 recruits histone deacetylase and is required for the function of multiple signaling centers during mouse embryogenesis.
14609955 2003 Isolation of human NURF: a regulator of Engrailed gene expression.
12920132 2003 The metastasis-associated proteins 1 and 2 form distinct protein complexes with histone deacetylase activity.
12705869 2003 MTA3, a Mi-2/NuRD complex subunit, regulates an invasive growth pathway in breast cancer.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12493763 2003 A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435631 2002 Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.
12124384 2002 The mCpG-binding domain of human MBD3 does not bind to mCpG but interacts with NuRD/Mi2 components HDAC1 and MTA2.
11788710 2002 Functional and physical interaction between the histone methyl transferase Suv39H1 and histone deacetylases.
11784859 2002 Role of the Sin3-histone deacetylase complex in growth regulation by the candidate tumor suppressor p33(ING1).
11118440 2001 Differential association of products of alternative transcripts of the candidate tumor suppressor ING1 with the mSin3/HDAC1 transcriptional corepressor complex.
11102443 2001 Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1.
10866654 2000 Histone binding protein RbAp48 interacts with a complex of CREB binding protein and phosphorylated CREB.
10471500 1999 Mi-2 complex couples DNA methylation to chromatin remodelling and histone deacetylation.
10444591 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.
10220405 1999 BRCA1 interacts with components of the histone deacetylase complex.
9804427 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.
9790534 1998 The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.
9765217 1998 Induction of Rb-associated protein (RbAp46) by Wilms' tumor suppressor WT1 mediates growth inhibition.
9651585 1998 SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.
9427644 1998 Nucleosomal DNA regulates the core-histone-binding subunit of the human Hat1 acetyltransferase.
9150135 1997 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.
7503932 1995 Dual retinoblastoma-binding proteins with properties related to a negative regulator of ras in yeast.
2005966 1991 A cellular protein that competes with SV40 T antigen for binding to the retinoblastoma gene product.