Property Summary

NCBI Gene PubMed Count 41
PubMed Score 20.17
PubTator Score 15.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6514 6.8e-06
Pick disease 1856 3.6e-03
atypical teratoid / rhabdoid tumor 4971 6.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Kabuki syndrome 27 3.692 1.8
Leukemia 103 3.601 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 6.3e-03
Pick disease 1.100 3.6e-03
psoriasis -2.900 6.8e-06

Gene RIF (10)

AA Sequence

MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVC      1 - 70
SLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDS     71 - 140
KHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKG    141 - 210
SCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWE    211 - 280
KSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERES    281 - 350
EFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPP    351 - 420
DAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKGS    421 - 490
KGKEKDSPFKPKLYKGDRGLPLEGSAKGKVQAELSQPLTAGGAISELL                          491 - 538
//

Text Mined References (50)

PMID Year Title