Property Summary

NCBI Gene PubMed Count 91
PubMed Score 51.83
PubTator Score 467.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 2.3e-09
osteosarcoma 7933 4.4e-08
Pick disease 1893 4.9e-05
group 3 medulloblastoma 2254 5.6e-03
subependymal giant cell astrocytoma 2287 1.1e-02
Disease Target Count Z-score Confidence
Retinoblastoma 14 4.654 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 3.496 4.4e-08
group 3 medulloblastoma 1.600 5.6e-03
subependymal giant cell astrocytoma -1.805 1.1e-02
Pick disease 1.300 4.9e-05
ovarian cancer -2.400 2.3e-09

Gene RIF (20)

PMID Text
26491019 RBBP4 functions as a novel regulatory factor to increase the efficiency of importin alpha/beta-mediated nuclear import
26376479 RbAp48 was identified as critical in the proliferation of hypopharyngeal carcinoma in both in vitro and in vivo experiments.
25601084 Our RBBP4-PHF6 complex structure provides insights into the molecular basis of PHF6-NuRD complex interaction and implicates a role for PHF6 in chromatin structure modulation and gene regulation.
25165715 Our results reveal that the protein structure does not affect ligand binding, and the top three TCM candidates Bittersweet alkaloid II, Eicosandioic acid, and Perivine might resolve the instability of the RbAp48-FOG1 complex
25150575 It is associated with episodic memory performance.
24920672 RbAp48 recognizes MTA1 using the same site that it uses to bind histone H4, showing that assembly into NuRD modulates RbAp46/48 interactions with histones.
23986399 The most significant change was an age-related decline in RbAp48, a histone-binding protein that modifies histone acetylation.
23178455 study of the interaction of the histone H3-H4 complex with the RbAp48 and their exchange with a second histone chaperone, anti-silencing function protein 1 (ASF1); exchange of histones H3-H4 between these two histone chaperones has a central role in the assembly of new nucleosomes
21689726 Data identified RBBP4 and RBBP9 as required for maintenance of multiple PS cell types, and both RBBPs were bound to RB in PS cells.
21047798 The FOG-1 peptide contacts a negatively charged binding pocket on top of the RbAp48 beta-propeller that is distinct from the binding surface used by RpAp48 to contact histone H4
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19454010 The SIN3/HDAC complex, composed of SIN3A, SAP30, SAP18, HDAC-1 AND -2 and RbAp46/48 ,except SAP30, interacts with HIV-1 Tat in Jurkat cell
19015307 Results report that transgenic expression of RbAp48 resulted in the development of autoimmune exocrinopathy resembling Sjogren's syndrome.
18577416 Data show that RbAp46 and RbAp48 interact with estrogen receptor (ER)alpha at endogenous, estrogen-responsive genes and alter expression of endogenous, ERalpha-activated and -repressed genes in MCF-7 breast cancer cells.
17974974 In conclusion, the data support a model whereby RbAp48 regulates cellular morphology and cytoskeletal organization by increasing K-Ras activity and signaling through MAPK.
17616526 RbAp48-mediated transformation of HPV16 is probably because of the regulation by RbAp48 of tumor suppressors retinoblastoma and p53, apoptosis-related enzymes caspase-3 and caspase-8, E6, E7, cyclin D1 (CCND1), and c-MYC.
17244783 RbAp48 is a NF-kappaB-regulated gene playing an important role in thyroid cancer cell autonomous proliferation.
14966907 expression of three (Beclin 1, RbAp48 and Pir51) were increased and one (aldolase b) was decreased in liver tumor tissues.
12893285 Upergulation of CAF-1 p48 subunit by overexpression of tuberous sclerosis gene products.

AA Sequence

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGT      1 - 70
HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCII     71 - 140
ATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV    141 - 210
PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLS    211 - 280
FNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKI    281 - 350
GEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP    351 - 420
EGQGS                                                                     421 - 425
//

Text Mined References (103)

PMID Year Title
27144666 2016 The MTA1 subunit of the nucleosome remodeling and deacetylase complex can recruit two copies of RBBP4/7.
26491019 2015 Retinoblastoma-binding Protein 4-regulated Classical Nuclear Transport Is Involved in Cellular Senescence.
26376479 2015 RbAp48 Is Critical for the Proliferation of Hypopharyngeal Carcinoma.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25601084 2015 Structural basis of plant homeodomain finger 6 (PHF6) recognition by the retinoblastoma binding protein 4 (RBBP4) component of the nucleosome remodeling and deacetylase (NuRD) complex.
25416956 2014 A proteome-scale map of the human interactome network.
25165715 2014 Lead discovery for Alzheimer's disease related target protein RbAp48 from traditional Chinese medicine.
25150575 2014 Genetic variants in a 'cAMP element binding protein' (CREB)-dependent histone acetylation pathway influence memory performance in cognitively healthy elderly individuals.
24920672 2014 Insight into the architecture of the NuRD complex: structure of the RbAp48-MTA1 subcomplex.
24554700 2014 Structural and functional insights into the human Börjeson-Forssman-Lehmann syndrome-associated protein PHF6.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23986399 2013 Molecular mechanism for age-related memory loss: the histone-binding protein RbAp48.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23273982 2013 An H3K36 methylation-engaging Tudor motif of polycomb-like proteins mediates PRC2 complex targeting.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178455 2013 Structural plasticity of histones H3-H4 facilitates their allosteric exchange between RbAp48 and ASF1.
23104054 2012 Phf19 links methylated Lys36 of histone H3 to regulation of Polycomb activity.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21689726 2011 Retinoblastoma-binding proteins 4 and 9 are important for human pluripotent stem cell maintenance.
21269460 2011 Initial characterization of the human central proteome.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
21047798 2011 Insights into association of the NuRD complex with FOG-1 from the crystal structure of an RbAp48·FOG-1 complex.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20127688 2010 Increased interaction between DJ-1 and the Mi-2/ nucleosome remodelling and deacetylase complex during cellular stress.
20075857 2010 JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19703393 2009 LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19644445 2009 ZIP: a novel transcription repressor, represses EGFR oncogene and suppresses breast carcinogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19015307 2008 Expression of the retinoblastoma protein RbAp48 in exocrine glands leads to Sjögren's syndrome-like autoimmune exocrinopathy.
18577416 2008 The role of retinoblastoma-associated proteins 46 and 48 in estrogen receptor alpha mediated gene expression.
17974974 2007 RbAp48 regulates cytoskeletal organization and morphology by increasing K-Ras activity and signaling through mitogen-activated protein kinase.
17827154 2007 Differential distribution of unmodified and phosphorylated histone deacetylase 2 in chromatin.
17671431 2007 LINC, a human complex that is related to pRB-containing complexes in invertebrates regulates the expression of G2/M genes.
17616526 2007 RbAp48 is a critical mediator controlling the transforming activity of human papillomavirus type 16 in cervical cancer.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17244783 2007 RbAp48 is a target of nuclear factor-kappaB activity in thyroid cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16429158 2006 Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
15701600 2005 MBD3L2 interacts with MBD3 and components of the NuRD complex and can oppose MBD2-MeCP1-mediated methylation silencing.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456747 2004 MBD3L1 is a transcriptional repressor that interacts with methyl-CpG-binding protein 2 (MBD2) and components of the NuRD complex.
15451426 2004 Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex.
15225548 2004 SUZ12 is required for both the histone methyltransferase activity and the silencing function of the EED-EZH2 complex.
14966907 2004 Genes encoding Pir51, Beclin 1, RbAp48 and aldolase b are up or down-regulated in human primary hepatocellular carcinoma.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645126 2004 Atrophin 2 recruits histone deacetylase and is required for the function of multiple signaling centers during mouse embryogenesis.
14609955 2003 Isolation of human NURF: a regulator of Engrailed gene expression.
12943729 2003 Dual mechanisms of regulation of transcription of luteinizing hormone receptor gene by nuclear orphan receptors and histone deacetylase complexes.
12920132 2003 The metastasis-associated proteins 1 and 2 form distinct protein complexes with histone deacetylase activity.
12893285 2003 Regulation of PCNA and CAF-1 expression by the two tuberous sclerosis gene products.
12705869 2003 MTA3, a Mi-2/NuRD complex subunit, regulates an invasive growth pathway in breast cancer.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12628926 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1.
12493763 2003 A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435631 2002 Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.
12430566 2002 Cloning and molecular characterization of the Schistosoma mansoni genes RbAp48 and histone H4.
12351676 2002 Role of histone H3 lysine 27 methylation in Polycomb-group silencing.
12124384 2002 The mCpG-binding domain of human MBD3 does not bind to mCpG but interacts with NuRD/Mi2 components HDAC1 and MTA2.
12091390 2002 Silencing of transcription of the human luteinizing hormone receptor gene by histone deacetylase-mSin3A complex.
11788710 2002 Functional and physical interaction between the histone methyl transferase Suv39H1 and histone deacetylases.
11784859 2002 Role of the Sin3-histone deacetylase complex in growth regulation by the candidate tumor suppressor p33(ING1).
11777905 2002 Human class I histone deacetylase complexes show enhanced catalytic activity in the presence of ATP and co-immunoprecipitate with the ATP-dependent chaperone protein Hsp70.
11470869 2001 The histone deacetylase HDAC3 targets RbAp48 to the retinoblastoma protein.
11331609 2001 Sharp, an inducible cofactor that integrates nuclear receptor repression and activation.
11302704 2001 Homo-oligomerisation and nuclear localisation of mouse histone deacetylase 1.
11118440 2001 Differential association of products of alternative transcripts of the candidate tumor suppressor ING1 with the mSin3/HDAC1 transcriptional corepressor complex.
11102443 2001 Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1.
11013263 2000 A novel nuclear receptor corepressor complex, N-CoR, contains components of the mammalian SWI/SNF complex and the corepressor KAP-1.
10961924 2000 Co-repressor complexes and remodelling chromatin for repression.
10866654 2000 Histone binding protein RbAp48 interacts with a complex of CREB binding protein and phosphorylated CREB.
10819992 2000 ATP-Dependent histone octamer mobilization and histone deacetylation mediated by the Mi-2 chromatin remodeling complex.
10734134 2000 RbAp48 belongs to the histone deacetylase complex that associates with the retinoblastoma protein.
10471500 1999 Mi-2 complex couples DNA methylation to chromatin remodelling and histone deacetylation.
10471499 1999 MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex.
10444591 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.
10220405 1999 BRCA1 interacts with components of the histone deacetylase complex.
10220385 1999 Three proteins define a class of human histone deacetylases related to yeast Hda1p.
9804427 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.
9790534 1998 The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.
9651585 1998 SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.
9614144 1998 Nucleosome assembly activity and intracellular localization of human CAF-1 changes during the cell division cycle.
9520398 1998 A role for histone deacetylase activity in HDAC1-mediated transcriptional repression.
9427644 1998 Nucleosomal DNA regulates the core-histone-binding subunit of the human Hat1 acetyltransferase.
9150135 1997 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.
8858152 1996 Nucleosome assembly by a complex of CAF-1 and acetylated histones H3/H4.
8602529 1996 A mammalian histone deacetylase related to the yeast transcriptional regulator Rpd3p.
8350924 1993 A retinoblastoma-binding protein related to a negative regulator of Ras in yeast.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7503932 1995 Dual retinoblastoma-binding proteins with properties related to a negative regulator of ras in yeast.
1699755 1990 Two-dimensional gel electrophoresis, protein electroblotting and microsequencing: a direct link between proteins and genes.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.