Property Summary

NCBI Gene PubMed Count 56
PubMed Score 59.46
PubTator Score 61.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.719 1.3e-03
malignant mesothelioma 1.300 1.2e-06
astrocytoma -1.600 3.2e-03
glioblastoma -1.300 1.7e-02
atypical teratoid / rhabdoid tumor -1.400 3.8e-06
hereditary spastic paraplegia -1.229 9.1e-03
limb girdle muscular dystrophy 2B -1.004 2.4e-03
sarcoidosis 1.100 9.4e-03
adult high grade glioma -1.100 1.8e-02
severe Alzheimer's disease -1.189 1.7e-02
spina bifida -1.594 4.1e-02
ovarian cancer 1.500 4.5e-03

Protein-protein Interaction (7)

Gene RIF (40)

PMID Text
26829385 MiR-20a and miR-20b negatively regulate autophagy by targeting RB1CC1/FIP200 in breast cancer cells
26151896 RB1CC1 has been implicated in cell cycle progression, cell growth, cell proliferation, cell survival, cell spreading/migration and neurodegeneration.
24732589 RB1CC1 knockdown in PC3 cells enhances clonal growth in vitro and tumor growth in vivo.
24610824 miR-133b targeted and downregulated RB1CC1 in prostate cancer cells.
23960084 Liver-specific deficiency of FIP200 leads to chronic liver injury associated with fibrosis and inflammation.
23262492 Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy.
22751121 The APC-independent beta-catenin degradation by FIP200 suggests a role for FIP200 in tumor suppression in the presence of APC dysfunction.
22396748 analysis of preparation of the monoclonal antibody for RB1CC1
22049074 RB1CC1 protein suppresses type II collagen synthesis in chondrocytes and causes dwarfism
21795712 RB1CC1 thus appears to play a unique role as a modulator of TGF-beta signaling by restricting substrate specificity of Arkadia.
21775823 p53 regulates autophagy through a direct molecular interaction with RB1CC1/FIP200, a protein that is essential for the very apical step of autophagy initiation.
21717524 Nuclear expression of RB1CC1 predicts a better clinical outcome and is useful in the follow-up of salivary gland cancers.
21637919 RB1CC1 activates the expression of p16 (also called INK4a/CDKN2a) through the activation of its promoter. RB1CC1 essentially requires binding with hSNF5 to activate the p16 promoter.
21602932 downregulation of FIP200 protein in glioblastoma tumor cells, astrocytes, and brain microvessel endothelial cells promotes apoptosis, most likely due to the removal of a direct interaction of FIP200 with Pyk2 that inhibits Pyk2 activation
21203526 RB1CC1, RB1 and p53 have prognostic roles in breast cancer in Japanese patients
20614030 present study indicates that RB1CC1 together with hSNF5 and/or p53 enhances the RB1 pathway through transcriptional activation of RB1, p16 and p21
20453000 Observational study of gene-disease association. (HuGE Navigator)
19888451 the 3'-untranslated region of RB1-inducible coiled-coil 1 gene is mutated in colon tumors
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690328 Studies elucidated the inhibitory mechanism in which mTORC1 phosphorylates the autophagy regulatory complex containing unc-51-like kinase 1 (ULK1), the mammalian Atg13 protein, and focal adhesion kinase interacting protein of 200 kD (FIP200).
19625176 Observational study of gene-disease association. (HuGE Navigator)
19437535 Nuclear RB1CC1 directly activates the RB1 promoter to enhance RB1 expression associated with breast cancer.
19437535 Nuclear RB1CC1 directly activates the RB1 promoter to enhance RB1 expression in cancer cells.
19258318 ATG13 and ULK1 are phosphorylated by the mTOR pathway in a nutrient starvation-regulated manner, indicating that the ULK1.ATG13.FIP200 complex acts as a node for integrating incoming autophagy signals into autophagosome biogenesis.
19225151 The ULK-Atg13-FIP200 complexes are direct targets of mTOR and important regulators of autophagy in response to mTOR signaling.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of RB1-inducible coiled-coil 1 (RB1CC1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18676680 Observational study of gene-disease association. (HuGE Navigator)
18443221 These results suggest that FIP200 is a novel mammalian autophagy factor that functions together with ULKs.
18285457 provide the first evidence for the existence of a close-spatially controlled-mode of regulation of FIP200 and PIASy nucleocytoplasmic functions
18036779 Cellular functions of FIP200 and its interacting proteins, and the emerging roles of FIP200 in embryogenesis and cancer development. Review.
17707572 RB1CC1 and PACE4 genes might be the DNA targets of sodium arsenite treatment in human lymphoblastoid cells.
17706618 RB1CC1 insufficiency causes neuronal atrophy through mTOR signaling alteration and involved in the pathology of Alzheimer's diseases.
16061648 FIP200 increases p21 protein levels via stabilization of its upstream regulator p53 and decreases cyclin D1 protein. Both effects are critical for FIP200-induced G1 arrest and may contribute to the antitumor activities of FIP200 in breast cancer.
16043512 FIP200 regulates of cell size by interaction with the TSC1-TSC2 complex.
15968549 Rb1cc1 expression is a prerequisite for the induction of RB1 and myosin heavy chain. Rb1cc1 plays a crucial role in muscular differentiation and function.
15375585 expression and promoter activities of RB1CC1 in developing murine and human tissues; RB1CC1 expression is controlled more stringently by modification at intron 1 in humans than in mice
14533007 RB1CC1 induces the expression of RB1, especially of underphosphorylated forms, then suppresses cell cycle progression in human neoplastic cells
12163359 RB1CC1 gene preferentially expressed and contributed to the maturation of human embryonic musculoskeletal cells, and may regulate the proliferative activity and maturation of tumor cells derived from these tissues.
12068296 RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor-suppressor gene.

AA Sequence

MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNP      1 - 70
IFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQLALEMYEVAKKLCSFCEGLV     71 - 140
HDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTR    141 - 210
HSYRECLGRLDSLPEHEDSEKAEMKRSTELVLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRE    211 - 280
SCQSTVHQQDETTIDTKDGDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQT    281 - 350
IAKLDNQNMKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQL    351 - 420
MIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLERVKIVEALS    421 - 490
TVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGKLFRKSFLRNRLFRGLDSWPP    491 - 560
SFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQ    561 - 630
TITDLLSEQKASVSQTSPQSASSPRMESTAGITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTF    631 - 700
DFETIPHPNIEQTIHQVSLDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVIN    701 - 770
AIDSRRMQDTNVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCT    771 - 840
AVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELVCLEEVLQNKD    841 - 910
NEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLEDLKKLHVENDEKLQLLRAEL    911 - 980
QSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKENQQIINQIQESHAEIIQEKEKQLQELKLKV    981 - 1050
SDLSDTRCKLEVELALKEAETDEIKILLEESRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQV   1051 - 1120
GLAELRTLMTIEKDQCISELISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSAL   1121 - 1190
ERQKDEKITQQEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKEL   1191 - 1260
LEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQT   1261 - 1330
NFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPS   1331 - 1400
PYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKE   1401 - 1470
EENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDL   1471 - 1540
KPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV                   1541 - 1594
//

Text Mined References (68)

PMID Year Title
26829385 2016 MiR-20a and miR-20b negatively regulate autophagy by targeting RB1CC1/FIP200 in breast cancer cells.
26151896 2013 Duplications in RB1CC1 are associated with schizophrenia; identification in large European sample sets.
24732589 2014 Tumor-suppressive functions of 15-Lipoxygenase-2 and RB1CC1 in prostate cancer.
24610824 2014 Identification of miR-133b and RB1CC1 as independent predictors for biochemical recurrence and potential therapeutic targets for prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23960084 2013 Autophagy deficiency by hepatic FIP200 deletion uncouples steatosis from liver injury in NAFLD.
23392225 2013 FIP200 regulates targeting of Atg16L1 to the isolation membrane.
23289756 2013 The COP1 E3-ligase interacts with FIP200, a key regulator of mammalian autophagy.
23262492 2013 Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043107 2012 ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs.
22751121 2013 FIP200 inhibits ?-catenin-mediated transcription by promoting APC-independent ?-catenin ubiquitination.
22396748 2012 Preparation of mouse monoclonal antibody for RB1CC1 and its clinical application.
22049074 2011 RB1CC1 protein suppresses type II collagen synthesis in chondrocytes and causes dwarfism.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21795712 2011 RB1CC1 protein positively regulates transforming growth factor-beta signaling through the modulation of Arkadia E3 ubiquitin ligase activity.
21775823 2011 p53 inhibits autophagy by interacting with the human ortholog of yeast Atg17, RB1CC1/FIP200.
21717524 2012 Prognostic significance of RB1-inducible coiled-coil 1 in salivary gland cancers.
21637919 2011 RB1CC1 activates the p16 promoter through the interaction with hSNF5.
21602932 2011 Downregulation of FIP200 induces apoptosis of glioblastoma cells and microvascular endothelial cells by enhancing Pyk2 activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21203526 2010 RB1CC1 together with RB1 and p53 predicts long-term survival in Japanese breast cancer patients.
20614030 2010 RB1CC1 activates RB1 pathway and inhibits proliferation and cologenic survival in human cancer.
20562859 2010 Network organization of the human autophagy system.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19888451 2009 Screening for microsatellite instability identifies frequent 3'-untranslated region mutation of the RB1-inducible coiled-coil 1 gene in colon tumors.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690328 2009 mTORC1 phosphorylates the ULK1-mAtg13-FIP200 autophagy regulatory complex.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19597335 2009 Atg101, a novel mammalian autophagy protein interacting with Atg13.
19437535 2009 RB1CC1 activates the promoter and expression of RB1 in human cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19258318 2009 ULK1.ATG13.FIP200 complex mediates mTOR signaling and is essential for autophagy.
19225151 2009 ULK-Atg13-FIP200 complexes mediate mTOR signaling to the autophagy machinery.
19211835 2009 Nutrient-dependent mTORC1 association with the ULK1-Atg13-FIP200 complex required for autophagy.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18443221 2008 FIP200, a ULK-interacting protein, is required for autophagosome formation in mammalian cells.
18285457 2008 Spatial interplay between PIASy and FIP200 in the regulation of signal transduction and transcriptional activity.
18036779 2008 FIP200, a key signaling node to coordinately regulate various cellular processes.
17707572 2007 Use of RAPD to detect sodium arsenite-induced DNA damage in human lymphoblastoid cells.
17706618 2007 RB1CC1 insufficiency causes neuronal atrophy through mTOR signaling alteration and involved in the pathology of Alzheimer's diseases.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17224074 2007 Somatic sequence alterations in twenty-one genes selected by expression profile analysis of breast carcinomas.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16865226 2006 Neuromuscular abundance of RB1CC1 contributes to the non-proliferating enlarged cell phenotype through both RB1 maintenance and TSC1 degradation.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16061648 2005 Mechanism of cell cycle regulation by FIP200 in human breast cancer cells.
16043512 2005 Identification of FIP200 interaction with the TSC1-TSC2 complex and its role in regulation of cell size control.
15968549 2005 Rb1cc1 is critical for myoblast differentiation through Rb1 regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375585 2004 Expression and regulation of RB1CC1 in developing murine and human tissues.
14533007 2003 RB1CC1 suppresses cell cycle progression through RB1 expression in human neoplastic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221124 2002 Regulation of focal adhesion kinase by a novel protein inhibitor FIP200.
12163359 2002 Preferential expression of RB1-inducible coiled-coil 1 in terminal differentiated musculoskeletal cells.
12095676 2002 Isolation, characterization and mapping of the mouse and human RB1CC1 genes.
12068296 2002 Truncating mutations of RB1CC1 in human breast cancer.
11850849 2002 Identification of RB1CC1, a novel human gene that can induce RB1 in various human cells.
10769033 2000 Suppression of Pyk2 kinase and cellular activities by FIP200.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
7724523 1995 Stathmin interaction with a putative kinase and coiled-coil-forming protein domains.