Property Summary

NCBI Gene PubMed Count 846
PubMed Score 1092.14
PubTator Score 3208.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Urinary bladder cancer 34 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 5.828 2.9
Endometriosis 535 3.191 1.6
Uterine fibroid 29 3.102 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 1.371 1.4e-03
Rheumatoid Arthritis 1.100 4.6e-02
malignant mesothelioma 1.100 1.7e-03
astrocytic glioma 1.100 5.8e-03
ependymoma 1.600 1.0e-02
oligodendroglioma 1.300 6.2e-03
glioblastoma 1.600 8.6e-04
atypical teratoid / rhabdoid tumor 1.200 1.9e-05
medulloblastoma 1.700 3.2e-04
medulloblastoma, large-cell 2.000 1.1e-05
primitive neuroectodermal tumor 1.200 2.5e-04
juvenile dermatomyositis 1.053 1.7e-09
acute quadriplegic myopathy 1.068 2.9e-05
primary Sjogren syndrome 1.100 1.9e-03
dermatomyositis 1.500 2.9e-03

Gene RIF (614)

PMID Text
27012093 these results demonstrate complex links between different signaling cascades in stressed hMESC, implicating ERK, p38 and JNK in regulation of the premature senescence via p53/p21/Rb pathway.
26928463 AR activity was inversely associated with cell proliferation, whereas the expression of Fa complex genes was correlated with elevated cell cycle progression, expression of the E2F transcription factor 1 (E2F1) and loss of RB1.
26925970 The maternally inherited c.1981C>T/p.Arg661Trp RB1 allele retains sufficient tumor suppressor activity to prevent retinoblastoma development.
26810492 RB proteins stabilize interactions of the NuRD corepressor complex within the L1 promoter to effect L1 silencing
26783196 efficacy of irinotecan on colorectal cancer could be predicted by phosphorylated RB expression, which is known to be crucial for G1/S progression and cell proliferation
26718407 These data suggest that CBX8 modulates SIPS through the RB-E2F1 pathway in CML cells and provide important insight into its application in CML treatment.
26713361 These data collectively suggest a novel mechanism involving CSLC-specific targeting by evodiamine and its possible use to the therapy of breast cancer.
26711265 The N terminus of the Retinoblastoma Protein (RB) inhibits DNA replication via interactions with Mcm7.
26708419 This inhibition was accompanied by a strong decrease in G1 cyclins (particularly in cyclin D1) and retinoblastoma protein (Rb) phosphorylation
26677227 Ras induces the formation of a complex between NORE1A and the phosphatase PP1A, promoting the activation of the Rb tumor suppressor by dephosphorylation
26676380 Rb knockdown reversed RBEL1 depletion-induced tumor suppressive effects. In conclusion, the present results suggest that RBEL1 modulates cell proliferation and G1S transition by inhibiting Rb in osteosarcoma
26647789 These results indicate that the loss of RB1 and CDKN2A function induces distinctively different signaling cascades in non-small cell lung carcinoma (NSCLC) and small cell lung carcinoma
26598524 TGFbeta induces autophagy through the pRb/E2F1 pathway and transcriptional activation of autophagy-related genes
26566968 The activation of E2Fs is intimately regulated by retinoblastoma 1 (RB1). The RB pathway has been implicated in almost every human malignancy
26548607 UHRF1 promotes osteosarcoma cell invasion by downregulating the expression of Ecadherin and increasing epithelialtomesenchymal transition in an Rb1dependent manner.
26539030 Spectrum of germ-line RB1 gene mutations has been described in Malaysian patients with retinoblastoma.
26442585 identified NRBE3 as a novel ubiquitin E3 ligase for RB that might play a role as a potential oncoprotein in human cancers
26397460 Loss of OTX2 expression resulted in decreased expression of C-MYC and CRX, genes previously implicated in retinoblastoma tumorigenesis. Loss of OTX2 expression increased the phosphorylation of RB, a potential mechanism of modulating cell proliferation
26396485 Molecular screening and identification of the RB1 mutations in Pakistani patients discovered novel mutational variants of the RB1 gene in the Pakistani population.
26378180 Deficiencies in Cellular Processes Modulated by the Retinoblastoma Protein Do Not Account for Reduced Human Cytomegalovirus Replication in Its Absence.
26360782 Bradykinin inhibits oxidative stress-induced senescence of endothelial progenitor cells through the B2R/AKT/RB and B2R/EGFR/RB signal pathways.
26339389 Expression rates of p16 and pRB differ according to the molecular subgroups of breast cancer and they subsequently correlate with clinicopathologic factors.
26319102 In this review, we discuss the role of the ubiquitin-proteasome system in proteolytic control of RB-E2F pathway components, and recent data that points to surprising non-proteolytic roles for the ubiquitin-proteasome system
26264229 RB1 mutation is associated with retinoblastoma.
26243836 gene amplification, p53 and Rb disruption, and E2F1 activation drive FOXM1 expression in epithelial ovarian cancer, and FOXM1 promotes cell cycle progression in cell models
26100623 An LXCXE motif in UL97 helps activate E2F-dependent promoters independently of its stimulatory effect on Rb phosphorylation.
26063518 Studies indicate that the non-hereditary form of retinoblastoma is caused by somatic mutations in the retinoblastoma RB1 gene, while the hereditary form is associated with germline mutations in the RB1 gene.
26058606 Results show that specific Rb (S795) residue was significantly highly phosphorylated in esophageal adenocarcinoma associated with aberrant P16 expression in the cancer tissues.
26043844 Coordinate pattern of Rb1+ and ER+ in HGSC and LGSC is 19 and 50%, respectively. Rb1 and P16 show inverse expression pattern according to tumor grade with more frequent Rb1 in low grade vs. more frequent P16 in grade 3 tumors
26032781 Report association between human papillomavirus and Epstein - Barr virus DNA and gene promoter methylation of RB1 and CDH1 in range of cervical lesions.
26009982 RB-mediated glycolytic activation induces a metabolic flux into the oxidative phosphorylation pathway.
25999316 For the subset of patients with heritable retinoblastoma-associated SNVs in the RB1 5' UTR, the absence of multiple structures is likely causative of the cancer
25928201 We demonstrated for the first time that targeted next generation sequencing of rb1 protein is an efficient approach for the identification of wide spectrum of pathogenic variants in RB patients.
25818292 data identify RB1 loss as a candidate driver of structural genomic instability and a causative factor for cancer somatic heterogeneity and evolution
25758528 RB is lost in resistant EGFR mutant lung adenocarcinomas that transform to small-cell lung cancer.
25712084 we re-tested a series of 40 patients with sporadic retinoblastoma: 10 of them had been previously classified as constitutional heterozygotes, whereas in 30 no RB1 mutations had been found in lymphocytes
25694602 Authors found that retinoblastoma tumor suppressor knockdown prior to infection impaired human cytomegalovirus lytic infection at multiple stages, notably viral DNA replication, late protein expression, and infectious virion production.
25684524 RB1 polymorphism contributes to the efficacy of platinum-taxanes in advanced squamous cell lung cancer.
25675863 Increased phosphorylated Rb is associated with Acute Lymphoblastic Leukemia.
25675300 results indicate that Pin1 has a critical role in the modulation of Rb function by the regulation of Rb dephosphorylation, which may have an important pathological role in cancer development.
25602518 There were seven individuals with germline mutations and all presented with advanced stage of tumor. There was no difference in age of onset of RB based on the germline mutation status.
25579178 co-transcription of ncRNA-RB1 and RB1 provides a positive link between the expression of the two tumor suppressors RB1 and the immune-relevant CALR protein
25486431 Cancer genome studies document recurrent genetic inactivation of RB1 and TP53, and the inactivation becomes more frequent in more advanced cancers. [Review]
25483096 These studies show that phosphorylation of Rb regulates its association with Bax and its role in apoptosis
25455074 RB maintains quiescence and prevents premature senescence through upregulation of DNMT1 in mesenchymal stromal cells
25451029 Data indicate that HPV16E7, CBP/p300, and retinoblastoma protein pRb interactions are potentially important for cellular transformation.
25446844 loss of RB1 protein expression by immunohistochemistry was seen in 4 four Merkel cell polyomavirus-negative primary salivary gland high-grade neuroendocrine carcinoma cases
25444922 High retinoblastoma protein expression is associated with chemosensitivity in hepatocellular carcinoma.
25424699 Our findings expand the spectrum of known RB1 mutations and will benefit the investigation of RB1 mutation hotspots. Genetic counseling can be offered to families with heritable RB1 mutations.
25368385 excess E2F1 due to Rb inactivation recruits the complex of Cdc20 and the anaphase-promoting complex/cyclosome to deregulate the expression of UBCH10
25348716 PRMT4 has a role in arginine methylation, which negatively regulates retinoblastoma tumor suppressor protein and promotes E2F-1 dissociation
25305068 Suppression of genes within the RB and p53 pathways induces cell cycle reentry in intact human pancreatic islets.
25294902 lower levels of pRb and cyclin D1 and higher levels of E2F1, a member of the E2F family, were detected in tumors with RB1 alterations compared with tumors without RB1 alterations
25273089 work identifies RABL6A as a novel negative regulator of Rb1
25266839 Two RB1 mutations were found in the tumor; one RB1 mutation was present in 10% of blood cells, identifying mosaicsm.
25252974 post-mitotic human cone precursors are uniquely sensitive to Rb depletion; Rb knockdown induced cone precursor proliferation in prospectively isolated populations and in intact retina
25223380 Invasive breast cancers are treated in distinct fashions, and heterogeneity within the RB pathway relates to prognosis and response to commonly used therapeutics.
25218456 Rb94, which lacks the N-terminal 112 amino acid residues of the full-length protein, has a strong tumor-depressing effect in head and neck and bladder cancers.
25201325 no significant difference in expression between human papillomavirus-positive and -negative Bowen disease
25159481 The current study was conducted to query possible correlations among methylation statue of ATM gene, ATM/ RB protein expression, D1853N ATM polymorphism, telomere length, and clinicopathological characteristics of various types of brain tumors.
25049398 Binding of 53BP1 to methyl K810 occurs on E2 promoter binding factor target genes and allows pRb activity to be effectively integrated with the DNA damage response.
25046224 CDKN2A/RB1 increased in a stepwise manner from the normal mucosa, to esophagitis, dysplasia/carcinoma in situ, and carcinoma (P<0.01). CDKN2A/RB1 was not expressed in the esophageal mucosa of patients without risk factors.
25028469 role of CDK4 in maintaining liposarcoma proliferation through its ability to inactivate RB function
25003838 Ki-67 may be a useful marker for discriminating benign from borderline PTs, and p16 and pRb may be a useful combination of markers for distinguishing FA from benign PTs in core biopsy specimen.
24987858 results showed for the first time that the Rb signaling pathway is essential for mediating the antineoplastic activity of erufosine and its efficacy in patients with malignant diseases may be predicted by determining the Rb status.
24935581 the use of p53 and pRB protein expression has no contribution in the situation where there is a diagnostic difficulty in deciding between hepatocellular carcinoma and hepatoblastoma.
24919196 Rb is present in HIF1alpha-ARNT/HIF1beta transcriptional complexes associated with TRIP230 as determined by co-immuno-precipitation, GST-pull-down and ChIP assays
24913233 Frequent disruption of the RB pathway in indolent follicular lymphoma suggests a new combination therapy.
24892564 The girl with diffuse infiltrating RB was found to be heterozygous for an oncogenic mutation in the RB1 gene that was also carried by both brothers and the father of the family
24888624 Findings indicate that both genetic and epigenetic retinoblastoma gene (RB1) changes may contribute to the pathogenesis of head and neck cancer (HNC) in the Pakistani population.
24876129 Cyclin D has a role in activating the Rb tumor suppressor by mono-phosphorylation
24858910 retinoblastoma RB1 -/- cells cannot survive in the absence of MED4, both in vitro and in orthotopic xenograft models in vivo, therefore identifying MED4 as a survival gene in retinoblastoma.
24838394 Loss of imprinting represents an important additional mechanism for RB1 pathway inactivation in human hepatocellular carcinoma, complementing well-described molecular defects.
24824777 Retinoblastoma protein potentiates the innate immune response in hepatocytes.
24823443 MDM2 serves as a better target for HAUSP-mediated deubiquitination in cancer cells, facilitating degradation of Rb and oncogenic progression.
24810223 Identification of RB1 gene alterations in patients with retinoblastoma improves clinical management of patient and relatives at risk
24809452 PTP-1B, SHP-2, and PTEN all play a functional role in Rb/E2F-associated apoptotic signal transduction
24798001 mutations can be used as a prognostic molecular biomarker for resectable hepatocellular carcinoma
24792491 our results demonstrate a combined mechanism for the anti-proliferative effects of FRK by inhibiting cyclin D1 nucleus accumulation and pRb phosphorylation in glioma cells.
24791139 Thirty-four distinct mutations were identified in RB1 gene in 40 (47.1%) of the 85 probands (36 bilateral and four unilateral), of which 20% (8/40) was identified by multiplex ligation-dependent probe amplification.
24771265 Our findings suggest that EZH2-specific microRNA-98 can effectively inhibit cell proliferation in vitro and regulate the pRb-E2F pathway in human ovarian cancer
24747969 studies revealed upregulation of p16, pRb dephosphorylation and its interaction with histone deacetylase 1/2
24727455 Together these findings identify a novel physical and functional interaction between EAF2 and the Rb pathway.
24703840 Data show that the crosstalk between the Rb-AKT-signaling pathways forms this switch by controlling the overlapping functions of FoxO3a and FoxM1 transcription factors in cultured fibroblasts.
24688104 Studied RB1 mutations in a unique nationwide cohort of Rb patients from the Netherlands.
24613344 Enhancement of chromosome cohesion suppresses genome instability in pRB-deficient cells.
24509483 This is the first report of chromothripsis as a mechanism for RB1 gene inactivation in cancer.
24485087 Provide evidence of posttranscriptional downregulation of Smurf2 in triple-negative breast cancers, and demonstrate that the loss of RB function is involved in microRNA-mediated interference with Smurf2 translation.
24433316 This is the first report of a 13q deletion associated with infantile hemangioendothelioma of the liver.
24406863 Retinoblastoma pathway dysregulation leads to an overlapping Merkel cell carcinoma phenotype and oncogenesis occurs through either a polyomavirus-dependent (viral large T antigen expression) or polyomavirus-independent (host somatic mutation) mechanism.
24371076 LT-Ag bind to Rb and release Rb-dependent repression of E2F-regulated transcription.
24350565 Retinoblastoma protein (pRB) have a novel function in regulating the mitotic function of NuMA and spindle organization, which are required for proper cell cycle progression.
24347427 Parallel analysis of somatic mutations among known cancer genes allowed us to identify RB1 as a new actor in aggressive adrenocortical carcinomas.
24336157 Analyses of Rb pathway mechanistic differences revealed frequent RB1 genomic alterations such as RB1 allelic loss and/or large spanning deletions in high-grade serous carcinoma.
24335704 E2F1/Rb pathways are altered by HHV-6, which then uses the E2F1 transcription factor to express viral genes
24334458 Retinoblastoma dysfunction converts TGF-beta to a mitogen that activates known oncogenic signaling pathways and upregulates Wnt7b.
24324613 Rb suppresses collective invasion, circulation and metastasis of breast cancer cells in CD44-dependent manner.
24323898 Rb gene loss is a critical event in the development of small cell carcinomas.
24323028 Data indicate that seven genes showed statistical enrichment for mutation: TP53, RB1, PTEN, NFE2L2, KEAP1, MLL2, and PIK3CA.
24302570 results reveal a novel non-nuclear function for Rb and suggest a potential mechanism of TNF-alpha-induced disruption of sarcomeric organization
24292676 Deletion of Rb in renin-expressing compartment of pancreas leads to highly penetrant metastatic pancreatic neuroendocrine carcinoma.
24281253 the inactivation of RB1 or RB2/P130 in uncommitted bone marrow stromal cells facilitates the first steps of adipogenesis.
24269417 RB1 mutations were sought in retinoblastoma patients who also had pineal cysts. Germline mutations were found in 100% of bilateral retinoblastomas and 25% of unilateral ones. Nonsense-frameshift mutations were more common in bilateral disease.
24254306 high rate/frequency of p14ARF, p15INK4B, and p16INK4A methylation was detected in hepatocellular carcinoma (HCC) with hepatitis B virus infection than in HCC without virus infection
24240190 CDK2 knockdown alters the profile of Rb phosphorylation in coronary artery smooth muscle cells, as well as the proliferative response of these cells to mitogenic stimulation.
24231354 RB1 expression correlated with that of the senescence-associated secretory phenotype cassette in human osteosarcomas. Low expression of both RB1 & the SASP genes was associated with poor prognosis.
24225018 Studied the spectrum of genetic and epigenetic changes of RB1 identified in 194 Retinoblastoma tumours and 209 blood samples, from 403 unrelated RB patients.
24189068 PRMT5 knockdown in non-Hodgkin lymphoma cell lines and primary lymphoma cells leads to RBL2 derepression and RB1 reactivation, which in turn inhibit PRC2 expression.
24170547 Nimbolide mediated inhibition of retinoblastoma protein phosphorylation causes cell-cycle arrest and suppresses glioblastoma growth.
24135281 Cdk5 signaling via Rb is critical to medullary thyroid carcinoma tumorigenesis and progression
24121271 A key role for the RB pathway in invasion associated with breast tumor progression.
24103329 Authors find that phosphorylation of S788 and S795 weakens the direct association between the N-terminal portion of the retinoblastoma protein C-terminal domain and the marked-box domains of E2F.
24078560 Sixteen germline mutations were identified in Chinese patients with retinoblastoma.
24062075 Expression of cell cycle regulatory factors hus1, gadd45a, rb1, cdkn2a and mre11a correlates with expression of clock gene per2 in human colorectal carcinoma tissue.
23981928 RB1 recurrent mutations in retinoblastoma analized by ARMS-PCR.
23981575 miR-215 targets retinoblastoma tumor-suppressor gene 1 (RB1) through its 3'-UTR in gastric cancer cells.
23969248 Rb protein is essential to the senescence-associated heterochromatic foci formation induced by HMGA2.
23967231 Genomic deregulation of the E2F/Rb pathway leads to activation of the oncogene EZH2 in small cell lung cancer.
23967107 RB phosphorylation and beta-catenin nuclear translocation are differently expressed in Crohn's disease and ulcerative colitis
23949216 RB represents a molecular link between autophagy and apoptosis, and a resistance marker in glioblastomas.
23936312 WT1 is an oncogene and promotes NSCLC cell proliferation by up-regulating Cyclin D1 and p-pRb expression
23932364 Involvement of SNIP1 in progression of lung cancer by regulating the RB/HDAC1 interaction.
23916291 50% of malignant phyllodes display evidence of Rb/p16 pathway alterations, likely reflecting p16 or Rb inactivation.
23900873 This study suggests the alteration of p16 and pRb expression has been detected in carcinoma ex pleomorphic adenomas
23900870 deletions of RB1 and CDKN2A genes may contribute to the development of hyperleukocytic type of T-lineage acute lymphoblastic leukemia in children
23892435 CASZ1 inhibits cell cycle progression in neuroblastoma by restoring retinoblastoma protein activity.
23887295 We investigated the association between Rb and p16 protein expression and clinical outcome in no-special-type triple-negative breast carcinomas.
23859194 MAP kinase p38 and retinoblastoma protein signaling is required for DNA damage-mediated formation of senescence-associated heterochromatic foci in tumor cells.
23845465 Late events such as the loss of RB1 and gain of MDM2 appear to be related to the final mechanisms contributing to the metastatic establishment of osteosarcoma.
23832541 Data indicate there was no statistical significance observed between the immunoexpression of p16, p21, p27, and pRb with nodal metastasis, depth of invasion, and presence of vascular or perineural invasion.
23803020 The present study failed to demonstrate any conclusive role of cyclin D1/RB/ p16 pathway in carcinoma of the gallbladder.
23792446 the cooperative effect of inactivation of both pRB and p53 tumor suppressor pathways promotes Whole chromosome instability
23715307 3 new mutations were found in spontaneous retinoblastoma: g.156712delC (L662X), g.153293T>C (S634P), plus g.IVS20+2T>G, a consensus splice junction change. as well as an already reported somatic mutation.
23707559 EZH2-mediated signal loop, EZH2-CDK4/6-pRb-E2F1, is probably involved in GBM tumorigenicity, and this loop can be blocked by miRNA-138
23670186 The Rb1 gene inhibits the viability of retinoblastoma cells by regulating homologous recombination.
23618872 pRB potentiated TNFalpha-induced apoptosis even when translation was blocked.
23595191 Mutation in the RB1 gene predisposes to heritable retinoblastoma and to further secondary primary malignancies. Abnormal Rb protein may play a role in the pathogenesis of calcific aortic valve disease in the context of familial bicuspid aortic valves.
23532519 Fifteen substitutions (4 intronic and 11 exonic) were identified as probably or likely pathogenic. Four of these 11 exonic substitutions were novel.
23498719 Amplification of the MYCN oncogene might initiate retinoblastoma in the presence of non-mutated RB1 genes. These unilateral RB1(+/+)MYCN(A) retinoblastomas are characterised by distinct histological features.
23449391 p53 promotes VEGF expression and angiogenesis in the absence of an intact p21-Rb pathway.
23441118 Mutations in the RB1 gene are screened in a large cohort of Iranian patients using the multiplex ligation-dependent probe amplification (MLPA) technique for detecting deletions/duplications in retinoblastoma.
23429261 caspases contribute to trigger the mitochondrial apoptotic pathway by coupling Bcl-2/Bcl-xL inhibition to that of Mcl-1, via the pRb/E2F-1-dependent induction of Noxa
23427156 pRb inactivation is insufficient to restore efficient viral nuclear egress of human cytomegalovirus in the absence of UL97.
23408605 Authors show that only the proteasome 19S regulatory particle that normally participates in ubiquitin-dependent protein degradation, is required for human herpesvirus 5 pp71-mediated degradation of Rb and Daxx.
23383595 Loss of function of pRB was associated with tumor invasion and lymph node metastasis in esophageal squamous cell carcinoma. [Meta-Analysis]
23370776 Silencing of RB1 but not RB2/P130 decreases proliferative activity and impairs the differentiation potential of human mesenchymal stem cells.
23359405 This review emphasizes the importance of the mechanisms of RB1 gene inactivation in inducing cancer cell development.
23339186 these results suggest that nuclear beta-catenin-dependent RB stabilization suppresses TNF-induced apoptosis in caspase-8-positive colon cancer cells.
23315497 Rb1 seems to play a permissive role for human adipose tissue function, being downregulated in obesity and increased during differentiation of human adipocytes.
23308053 our data identify a potential role for pRB in regulating angiogenesis through modulation of Nuclear protein 7 expression.
23301675 This study enabled us to obtain information about molecular and genetic features of patients with retinoblastoma in Argentina and correlate them to their phenotype.
23289805 Clinicians should consider retinoblastoma as a diagnosis when faced with a patient with unexplained exudative retinal detachment.
23232572 High-grade bladder in situ/muscle-invasive carcinoma is characterized by alteration of p53 and pRB.
23178825 results suggest that miR-106a might have a regulatory role for Rb1 in sporadic colorectal cancer
23166591 Expression of HIV-1 Tat upregulates the abundance of retinoblastoma 1 (RB1) in the nucleoli of Jurkat T-cells
23157310 Molecular modeling and MD simulations of pRB in free and ligand-bound forms confirms that pRB could be a valid target for the anticancer drug design when the cancer is induced by the viral onco-proteins and forms a clear base for designing E7 antagonists.
23108995 Rb1 is a direct functional target of miR-26a.
23059827 A novel function for Rb is promoting cell survival through regulating the function of BAG-1.
23041127 the Rb gene regulatory network (GRN) subcircuit that regulates cell proliferation is linked to a GRN subcircuit regulating a tumor cell immune function.
22998184 pRB plays important roles through multiple functions in determining cell fate, i.e., normal growth/death and differentiation, or tumor formation.
22955272 Novel molecular mechanisms for the different expression patterns of E2F1 targets and the selectivity of retinoblastoma protein-mediated heterochromatin formation and gene repression during cellular senescence.
22895174 Dephosphorylation of threonine-821 of the retinoblastoma tumor suppressor protein (Rb) is required for apoptosis induced by UV and Cdk inhibition.
22874878 RB1 deletions are associated with relapse in multiple myeloma.
22802529 identify a causal role for E2F7 in cellular senescence and uncover a novel link between the RB and p53 pathways.
22790852 of the soft tissue tumors associated with 13q deletions, all spindle cell lipomas, pleomorphic lipomas, and cellular angiofibromas and most mammary-type myofibroblastomas show loss of Rb expression
22787429 -dependent RB1 methylation at lysine 810 promotes cell cycle progression of cancer cells. Further study may explore SMYD2-dependent RB1 methylation as a potential therapeutic target in human cancer.
22744425 Rb1 germline mutations may contribute to genetic susceptibility for head and neck cancer.
22730229 study observed associations between father's diet before his child's conception and risk of retinoblastoma in his child that results from a new germline RB1 mutation
22706203 RB1 was identified as a major target for genomic disruption in tumors arising in BRCA1 mutation carriers and in sporadic tumors with BRCA1 promoter methylation but rarely in other breast cancers.
22701041 Rb1 induction in chronic asymptomatic HIV-1 infection mediates apoptosis resistance in monocytes in association with protective autophagy and contributes to monocyte survival during immune activation and/or HIV-1 viremia.
22698402 Data indicate that endoreduplication and mitotic failure occur during telomere crisis in fibroblasts and mammary epithelial cells, and suggest the role of p53 and Rb in repressing tetraploidization.
22696061 Although the retinoblastoma protein (Rb) is known to regulate the growth of keratinocytes in a cell-autonomous manner, here we describe a function of Rb in the stromal compartment.
22692183 Loss of heterozygosity (LOH) of the retinoblastoma gene was detected in 25.6% of patients in intron 1 and in 37.2% of patients in intron 17.
22644489 This report identifies two additional PTPs, SHP-2 and PTP-PEST, that are also directly activated by the Rb-E2F pathway and which can contribute to signal transduction during p53-independent apoptosis.
22643222 Inactivation of Rb in stromal fibroblasts promotes epithelial cell invasion.
22586056 All cases of cellular angiofibroma, spindle cell lipoma and mammary-type myofibroblastoma showed monoallelic or biallelic loss of RB1. The absence of RB1 loss in solitary fibrous tumors suggests that they are not related.
22576742 the paramount expression of these cellular cycle biomarkers (p53 and Rb protein) in excisional biopsies may suggest that molecular lesion assessment plays a role in pre-malignant lesions.
22569856 Study reveals a novel role for Rb protein N-terminal in the mechanism of Rb inactivation and provides the first insights into the overall structure of the multidomain Rb protein. The distinct structural changes induced by particular phosphorylation events explain how multisite phosphorylation can differentially regulate Rb interactions with other proteins.
22493456 in various tumors types, there is an inverse correlation between the expression levels of gamma-tubulin and RB1 and that in tumor cell lines with a nonfunctioning RB1, reduction of gamma-tubulin protein levels leads to induction of apoptosis.
22448711 Studies indicate that retinoblastoma (RB) protein might possess many multifaceted and unique functions.
22366686 Data show that expression of RB1 repressed both the wild-type and let-7-mutated promoter.
22333593 The individual RB family proteins were sufficient for the establishment of p16-initiated senescence, and that growth arrest in G 1 was not dependent on the presence of functional pRb or p53.
22322860 The pRb isomerization done by Pin1 is essential for further phosphorylation of pRb and consequent inactivation.
22310660 E2F1 suppresses TLR3 transcription, but during immune stimulation, Rb is upregulated to block the inhibitory effect of E2F1 on TLR3, highlighting a role of Rb-E2F1 axis in the innate immune response in epithelial cells
22299668 Studies indicate that the Ser/Thr phosphatases PP1 and PP2A are responsible for the dephosphorylation and activation of Rb proteins.
22265791 The spectrum of germline and tumoral alterations included: three nonsense mutations; one mutation affecting splice site; one deletion and two polymorphisms
22262832 RB inactivation contributes to tumor progression not only through loss of cell cycle control but also through up-regulation of ZEB expression and induction of an invasive phenotype.
22219649 Ten RB1 germline mutations have been identified in 41 unrelated Moroccan patients with retinoblastoma.
22205104 RB1 genotype-phenotype correlation for second primary cancers of the hereditary retinoblastoma survivors
22203219 study suggests a weak paternal age effect for retinoblastom resulting from de novo germline mutations consistent with the paternal origin of most of these mutations
22184068 DNA damage signals alter pRB and E2F1 to engage them in functions leading to apoptotic induction that are distinct from pRB-E2F regulation in cell cycle control
22182413 Rb resulted in the c-Myc up-regulation in the liver of mt-Rb transgenic mice and then c-Myc activated several target genes in the tumor.
22157621 Complete loss of RB1 transcript expression is seen in 18 of 170 glioblastoma tumors which were highly enriched for, but not exclusive to, the proneural subtype.
22112645 An association between IVF or ICSI and retinoblastoma through this epigenetic mechanism is unlikely.
22084214 genetics can be incorporated into the management plan of all retinoblastoma patients using a team approach to ensure timely evaluations and appropriate counseling.
21956461 results suggest that in malignant epithelial cells beta-defensin-2 (BD-2)may control cell growth via arrest of G1/S transition and activation of retinoblastoma protein
21880723 the role of Rb in mediating the inverse relationship between elastogenesis and cellular proliferation.
21875955 Data suggest that the RB pathway may prevent hepatocellular carcinoma development by maintaining the quiescence of adult liver progenitor cells.
21855804 The LXCXE binding motif has an essential role in RB-mediated transcriptional control, response to genotoxic insult, and tumor suppression.
21850486 Bcl-2 gene transcription is regulated by Ap2alpha-Rb complex binding to the Bcl-2 promoter.
21809081 suggests that the pRb protein level is a promising marker for polyamine depletion sensitivity and that there is a connection between pRb and the regulation of SSAT activity
21763628 Eight known mutations of RB1 and four novel mutations (c.832_833insT, c.1943delC, c.1206C>T, and c.2029delG) were determined
21752283 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21740549 downstream effectors of the p53-p21 and p16-pRB tumour suppressor pathways crucial for mediating entry into senescence
21725359 identified concurrent mutational inactivation of the PTEN and RB1 tumor suppressors as a mechanism for loss of BRAF/MEK dependence in melanomas harboring (V600E)BRAF mutations
21674866 Linkage analysis revealed inheritance of RB1 alleles in 10 families with retinoblastoma.
21665145 show that chromosome instability (CIN) in cultured cells lacking Rb family proteins requires Mad2 upregulation and that this upregulation is also necessary for CIN and tumor progression in vivo
21663659 CTCF plays an important role in maintaining the Rb promoter in an optimal chromatin configuration.
21654082 study included 5 families with more than 1 member affected with retinoblastoma; study reveals novel effects of RB1 mutations on splicing
21615945 screened 30 family members from a retinoblastoma family;phenotypic variability associated with p.V654L mutation in exon 19 of RB1 gene in 11 family members was found; suggests RB1 p.V654L mutation is a typical mutation associated with low penetrance
21602887 results suggest that, in cancer, frequent and persistent expression of PAX8 is required for cell growth control through transcriptional activation of E2F1 expression and upregulation of the RB-E2F1 pathway
21593597 these findings are consistent with a causative link between defects in the BRCA1 gene by CpG island hypermethylation and the development of TNBCs characterized by RB/p16 dysfunction in sporadic cases of the disease.
21567202 Single nucleotide polymorphisms in p16, RB1 genes may affect the susceptibility to cervical cancer collectively.
21558273 C/EBPbeta reduces monocytic proliferation by affecting the retinoblastoma/E2F/cyclin E pathway and that it may contribute to, but is not directly required for, macrophage morphology.
21518927 p16INK4a/pRb may function as an alternative pathway of oncogene-induced senescence; the reactivation of p16INK4a expression might be a novel strategy to restore the senescence program in some tumors.
21498571 Results reveal a functional connection between the pRB and Hippo tumor suppressor pathways, and suggest that low levels of LATS2 may undermine the ability of pRB to induce a permanent cell cycle arrest in tumor cells.
21493295 Cancerous tissues from 30 patients with HPSCC were examined for LOH in 4 tumor suppressor genes (TSGs) (p16, Rb, E-cadherin, and p53) at loci 9p21, 13q21, 6q22, and 17p13, respectively, using microsatellite markers amplified by polymerase chain reaction.
21491492 The study found conditions in which crystals of the retinoblastoma protein pocket domain could be grown in the absence of any ligand, and we solved the structure to 2.5 A resolution.
21478909 ARF1 controls proliferation of breast cancer cells by regulating the retinoblastoma protein
21470325 a fraction of low-grade diffuse gliomas lacking common genetic alterations may develop through a distinct genetic pathway, which may include loss of cell-cycle control regulated by the RB1 pathway.
21447152 Data show that the expression of CCND1/CDKN2A correlated with RB1 status in xenograft tumors in vivo.
21440621 Retinoblastoma protein controls the human CD34 promoter region by antagonizing the CD34 promoter factor nucleolin to provide a mechanism that links expression of endogenous CD34 to cell cycle progression.
21387305 knockout of the two alleles of the RB1 gene is necessary and may be largely sufficient for the development of RB, in support of Knudson's two-hit hypothesis.
21329664 over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells.
21325879 Rb-loss sensitizes cells to autophagy via direct and indirect mechanisms.
21278246 p16 and retinoblastoma determines response to CDK4/6 inhibition in ovarian cancer
21253829 RB1 alterations do not play a major role in metastatic development of breast cancer.
21241471 Data show that the binding of scFv 43M2 to E7 was inhibited by pRb in a non-competitive manner.
21203526 RB1CC1, RB1 and p53 have prognostic roles in breast cancer in Japanese patients
21148318 CDK-mediated phosphorylation of both RBP1 and pRb induces their dissociation to mediate release of the mSin3.HDAC transcriptional repressor complex from pRb to alleviate transcriptional repression of E2F.
21119616 In pRb, lysine (K) 810 represents the essential and conserved basic residue (SPXK) required for cyclin/Cdk recognition and phosphorylation.
21099295 A new function for these factors in the control of insulin secretion and open up new avenues for the treatment of diabetes.
21099110 RB controlled nuclear receptor networks critical for tumor progression and that it did so via E2F transcription factor 1-mediated regulation of androgen receptor (AR) expression and output.
21085491 Data show that Orc1 specifically binds hypo-phosphorylated Rb and that this interaction is competitive with the binding of Rb to E2F1.
21055153 The methylation status of RB gene was correlated with lymph node metastasis, but not with the size, the differentiation status, ER expression of the breast cancer and the age of the patients.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21042734 Further investigation is required to assess whether the expression of Rb family proteins can potentially be used as a prognostic or predictive factor in gastric cancer.
20971808 CEBPD reverses RB/E2F1-mediated gene repression and participates in HMDB-induced apoptosis of cancer cells.
20948989 Data indicate that miR-449a is a miRNA component of the Rb pathway and its tumor suppressor-like effects, in part, depends on Rb status in prostate cancer cells.
20948316 Data provide evidence for a functional link between Hec1 expression and the pRb pathway.
20948315 These results indicate that the RB-loss signature expression is associated with poor outcome in breast cancer, but predicts improved response to chemotherapy based on data in ER-negative populations.
20940255 acetylation is required for nuclear localization and keratinocyte differentiation
20924203 Data show that proliferaton and nuclear expression of cyclin D1 and p-Rb coincide with the early phase of cyst growth, suggesting that there might be a therapeutic window in which cyclin-dependent kinase inhibitors are most effective in ARPKD.
20890425 Altered pRb was significantly correlated with overall survival and the expression pattern of pRb and p53, p53/pRb (altered/normal) had worse survival than p53/pRb (normal/altered).
20871633 Data show that phosphorylation by p38 triggers an interaction between Rb and the Hdm2, leading to degradation of Rb and cell death.
20870719 RB monomethylation at lysine 860 by SMYD2 provides a direct binding site for L3MBTL1.
20864684 Data indicate that local Sca-1low dermal mesenchymal stem/progenitor cells are preferential targets for malignant transformation associated with deficiencies in both p53 and Rb.
20713352 RB.E2F1 complex plays a critical role in ZBRK1 transcriptional repression, and loss of this repression may contribute to cellular sensitivity of DNA damage, ultimately leading to carcinogenesis.
20705054 these findings provide the first demonstration that SM22alpha modulates cellular senescence caused by damaging agents via regulation of the p16(INK4a)/pRB pathway in HepG2 cells and that these effects of SM22alpha are partially mediated by MT-1G.
20694007 protein phosphatase 1 competition with Cdk-cyclins for Rb binding is sufficient to retain Rb activity and block cell-cycle advancement.
20680693 Reduced expression of RB is associated with leiomyosarcoma.
20680651 E2F-1 associated pRB is modified by O-GlcNAc.
20668449 discovery of the first alpha-N-methyltransferase, which we named N-terminal RCC1 methyltransferase (NRMT).
20628002 Expression of constitutively active mTOR conferred resistance to cryptotanshinone inhibition of cyclin D1 expression and Rb phosphorylation, as well as cell growth.
20627193 Assaying tumor-specific RB1 mutations complements cytological and immunohistochemical assessment of retinoblastoma involvement of cerebrospinal fluid and bone marrow.
20614030 present study indicates that RB1CC1 together with hSNF5 and/or p53 enhances the RB1 pathway through transcriptional activation of RB1, p16 and p21
20596833 The structural and functional effect of pRB by significant nsSNP in the coding region of RB1 gene is reported.
20594292 findings suggest RB1 mutations to be of pathological importance potentially affecting sensitivity to mitomycin/anthracycline treatment in breast cancer
20565234 results show that in RB patients in Malaysia mutation frequency in pocket B of the E1A binding domain of the RB1 gene is lower; mutations in exons outside the pocket B domain may be associated with the disease in Malaysian RB patients
20558744 Findings suggest that Gadd45b mediates p38-induced Rb phosphorylation by enhancing the interaction between p38 and Rb during Fas-induced apoptosis in murine hepatocytes.
20551165 pRB depletion compromises centromeric localization of CAP-D3/condensin II and chromosome cohesion, leading to an increase in intercentromeric distance and deformation of centromeric structure
20534814 Rb1 is an important determinant of Tbx2 functional specificity.
20503270 in HPV positive oropharyngeal cancer, cyclin D1 has a role in locoregional recurrence, event and death and pRb has a role in event and death
20499310 analysis of immortalization of oral keratinocytes by functional inactivation of the p53 and pRb pathways
20453000 Observational study of gene-disease association. (HuGE Navigator)
20447117 Genetic analysis shows mutations of RB1 in all cases of retinoblastoma.
20435627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20428774 two spontaneously transformed human oral keratinocyte lines from adult human gingival samples revealed a mutation in the p53 gene, loss of p21WAF1/Cip1 and overexpression of p-Rb-Ser807
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20372802 stimulation of PP1 activity via siRNA mediated knockdown of its interacting protein PNUTS (Phosphatase Nuclear Targeting Subunit) leads to Rb dephosphorylation and apoptosis in cancer cells
20372796 high telomerase activity with intact p16/Rb could be a marker of stem cell origin in cancer cells
20362553 this study more generally suggests an interplay between RB and IDE within the proteasome that may have important growth-regulatory consequences.
20336668 The protein expression profiles of p53, p73, pRb family proteins, and PCNA in different cell lines of mouse primitive neuroectodermal tumors (PNET), and in human medulloblastoma cell lines, was examined.
20237430 In the absence of Rb, E2F1 overexpression results in apoptosis, not proliferation, and that this effect is independent of p53.
20226085 Microarray expression analysis indicated that E2F1 and E2F2 are downstream genes in the KDM5B pathway.
20226061 LIMD1 inactivation as primary event than inactivation of RB1 in head and neck squamous cell carcinoma development.
20226061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20223825 Phosphorylation-induced conformational changes in the retinoblastoma protein inhibit E2F transactivation domain binding.
20157766 Results suggest that reciprocal Notch signaling might be necessary for the proliferation and survival of HL60 cells, possibly through the maintenance of the expression of c-Myc and Bcl2, as well as the phosphorylation of the Rb protein.
20140018 Lysine methylation regulates the pRb tumour suppressor protein.
20100483 CDK4/6 inhibition is a potent mediator of cytostasis and that RB loss can be readily compensated for in the context of both hepatoma cell lines and liver tissue.
20090211 Studies developed a combinatorial approach for detection of recurrent mutations, large deletions/insertions and point mutations of RB1 gene in patients with Rb.
20082263 simultaneous detection of p53, Rb, p16, and EGFR in a suspension microarray facilitates rapid diagnosis of lung cancer
20059380 the bilaterally affected son and the unilaterally affected father were both heterozygous for the nonsense mutation c.1363C>T (p.R455X) in exon 14 of RB1
20041224 RB1 is imprinted in the same direction as CDKN1C, which operates upstream of RB1.
20037816 There are specific interactions among Rb, HDAC1 and E2F1 proteins in gallbladder carcinoma, indicating the existence of the direct Rb/E2F1/HDAC1 signal transduction pathway. p16 does not interact with any of these proteins.
20003272 findings indicate a novel aspect of pRb acute loss that promotes aneuploidy mainly by inducing CENPA overexpression
19950226 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19926638 RB is a direct target of miR-675 which suppressed a reporter carrying the RB 3'-UTR containing the miR-675-binding site. Transfection with anti-miR-675 increased RB expression & decreased cell growth & soft agar colony formation in colon cancer cells.
19919588 44% of Paget's disease of the vulva cases examined showed loss of expression of RB protein compared with 67% of Paget's disease of the breast cases.
19903334 Exposure of human cancer cell lines to caffeine and CGK733 was associated with a reduction in the levels of both phosphorylated and total retinoblastoma protein (
19883508 Retinoblastoma protein-depleted human fibroblasts showed the presence of micronuclei containing whole chromosomes besides the presence of supernumerary centrosomes and aneuploidy.
19880526 TFII-I plays an inhibitory role in regulating genes that are essential in osteogenesis and intersects with the bone-specific transcription factor Runx2 and the retinoblastoma protein, pRb.
19863319 The majority of tumours showed strong p16, p21, p27, pRb and cyclin D1 staining and little or no p53 expression. Tumours harbouring dysplasia were significantly more likely to be p53-positive and exhibit up-regulated p21 and p27.
19838216 Data show that SHP-1 knockdown increases p27stability, decreases the CDK6 levels, inducing retinoblastoma protein hypophosphorylation, downregulation of cyclin E and thereby a decrease in the CDK2 activity.
19817957 Observational study of gene-disease association. (HuGE Navigator)
19802012 Results show a cooperative relationship between the expression of Ras and loss of RB in providing a discrete proliferative advantage under physiologically relevant conditions.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
19723065 Data show that the inhibition of cell proliferation with L.lac CF was associated with an increase in p53 and p21 expression, the reduction of cyclin D1 expression, and retinoblastoma protein phosphorylation.
19666944 Cyclin D1 and pRb showed a progressive increase in expression from benign to malignant tumors but with relative decreases in the more advanced tumors (thick primaries and metastatic melanomas).
19648117 Data show that nutlin-3 activates p53 resulting in a dramatic increase in MDM2 expression and a marked reduction in total Rb protein levels.
19640284 Identification of RB1 mutations in hereditary retinoblastoma provides accurate risk prediction and valuable genetic counseling for patients and their families
19633425 Data show that sorafenib inhibited the raf/ MEK/ERK signal pathway, and downregulated cyclin D1 and Rb levels.
19631451 Data demonstrate that the novel anticancer mechanism of hinokitiol involves accumulation of p27, down-regulation of pRb, Skp2, and impairment of Cdk2 function.
19597473 miR-17-92 overexpression may serve as a fine-tuning influence to counterbalance the generation of DNA damage in RB-inactivated SCLC cells.
19594747 Observational study of gene-disease association. (HuGE Navigator)
19588502 Data show that Bac-ELP1-p21 caused a decrease in Rb phosphorylation levels in cells treated at 42 degrees C.
19556322 Patients with Triple-negative breast cancer lacking the retinoblastoma protein had a very favorable clinical outcome if treated with conventional adjuvant chemotherapy.
19477924 Cdh1 reciprocally regulates the Rb pathway through competing with E2F1 to bind the hypophosphorylated form of Rb.
19465901 the expression of p53, p21 and RB was not significantly different in penile verrucous carcinoma than in usual type squamous cell carcinoma.
19458004 Defect in virus replication is resulted from the inability of the mutated NS5B to regulate Rb abundance and thereby modulate host gene expression.
19430707 Results show that overexpression of CDK4, cyclin D1, and Rb proteins, and loss of expression of proteins p16, p27, and p19 were statistically significant in NPC tissues compared with non-cancerous NPE (P<0.05) by real-time RT-PCR and tissue microarray.
19421149 Data show that E2 induces a generalized re-localization of E7 within the cell nucleus, one potential consequence of which is the inhibition of E7-induced degradation of pRb.
19390654 identified 17 occurrences of 11 distinct germline mutations in two sporadic and in 15 familial cases of retinoma; the 11 identified mutations were located in exons 1, 10,11,13,14, and 19 to 23; 4 of the identified mutations were not previously reported
19389926 alterations in Rb expression may be essential for both the establishment and maintenance of phenotypic characteristics of Uterine carcinosarcomas
19383911 Observational study of gene-disease association. (HuGE Navigator)
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19280657 Mosaicism for an RB1 mutation is highly likely to manifest as retinoblastoma.
19279001 Data show that RB is associated with promoters in a manner similar to p107/p130 and that association is modulated by phosphorylation during cell cycle progression.
19258477 Observational study of gene-disease association. (HuGE Navigator)
19225156 Aurora B determines cellular fate after an aberrant mitosis by directly regulating the Rb tumor suppressor protein.
19212661 Cellular growth inhibition by FK778 is linked to G1 arrest or S phase accumulation, dependent on the functional status of the retinoblastoma protein.
19160091 Reduction in Rb1 expression due to methylation is associated with bladder cancer.
19152247 positive expression of retinoblastoma protein and cyclinD1 might be an early event in gastric carcinoma
19144636 AICAR and glucose deprivation might induce G1/G0 cell cycle arrest and suppress proliferation of NSCs via phospho-Rb and cyclin D down-regulation
19141402 Immunohistochemical analysis of Rb protein expression in neoplastic cells made it easier to evaluate the mechanisms of cancerogenesis in laryngeal cancer and is closely related to genetic alteration in Rb locus.
19140325 K-RAS point mutations, and anomalies of p16-RB1-cyclin D pathway could occur before LOH on 10q23 (PTEN) and microsatellite instability during tumor progression.
19137728 Epigenetic inactivation of the RB1 gene as a factor of genomic instability: a possible contribution to etiology of chromosomal mosaicism during human embryo development
19130399 Analysis of pRB expression in aggressive fibromatosis (desmoid tumor) is reported.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19058005 Expression of cyclin E could not predict survival in patients with gastric cancer, whereas the expression of pRb and p21 was associated with a favorable prognosis.
18976938 These findings outline the potential role of pRB immunostaining in predicting stage T1 grade 3 bladder cancer response to BCG immunotherapy
18950845 Observational study of gene-disease association. (HuGE Navigator)
18948382 These results indicate a ROS-independent but p53/retinoblastoma protein-dependent senescence mechanism during hyperoxia.
18801742 Proto-oncogene FBI-1 (Pokemon/ZBTB7A) represses transcription of the tumor suppressor Rb gene via binding competition with Sp1 and recruitment of co-repressors.
18794899 by retaining RB1 and amplifying CDK8, colorectal tumour cells select conditions that collectively suppress E2F1 and enhance the activity of beta-catenin
18794045 The p16INK4a/cyclin D1/pRB pathway was altered in gastrointestinal tract endocrine tumors, and the loss of expression of pRB may be helpful in identifying patients at high risk of metastasis in rectal well-differentiated endocrine neoplasms
18782450 Functional loss of RB1 is common in basal-like tumours, which may play a key role in dictating their aggressive biology and unique therapeutic responses.
18779498 Both siblings in each family described in this report developed unilateral unifocal retinoblastoma as a new germ-line RB1 mutation.
18768921 The extreme COOH terminus of the retinoblastoma tumor suppressor protein pRb is required for phosphorylation on Thr-373 and activation of E2F.
18766991 The patient was found to carry a de novo heterozygous deletion (g.59444 del196) that results in mis-splicing of exon 8 of RB1, producing a non-functional retinoblastoma protein.
18755268 MYPT1 may regulate the phosphorylation level of pRb, thereby it may be involved in the control of cell cycle progression and in the mediation of chemoresistance of leukemic cells.
18702872 Karyotyping and FISH assessment for chromosomal abnormalities in the RB1 gene corrates with survival in B-cell chronic lymphocytic leukemiae.
18697743 phosphatases and pRB have important roles in IGF-I/mTOR-mediated cell survival
18694959 These results indicate that PRMT5 overexpression epigenetically alters the transcription of key tumor suppressor genes.
18691182 With tumor suppressor protein p53, RB1 is involved in proteasome inhibition cell senescence.
18677770 Mutations in RB1 in melanoma by inhibition of nonsense-mediated mRNA decay.
18677112 Low-penetrant RB allele in small-cell cancer shows geldanamycin instability and discordant expression with mutant ras.
18632617 SerpinB2 is a cell survival factor that modulates Rb repression of proapoptotic signal transduction
18624751 The first in vitro evidence for an important role of C DKN2A/p16 and CDK4 in chondrosarcoma cell survival and proliferation, is presented.
18593909 Rb inactivation contributes to tumor progression due to not only loss of cell proliferation control but also conversion to an invasive phenotype.
18546941 We did not observed any correlation between Rb and other clinocopathological features
18503160 We screened for RB1 gene sequence alterations in both peripheral blood and tumor specimens from a total of 48 Mexican retinoblastoma patients...mutation analysis was not helpful to distinguish sporadic and hereditary retinoblastoma
18483265 the Rb/Raf-1 interaction has a role in cell proliferation and angiogenesis
18477220 A rare gliosarcoma with liposarcomatous differentiation showed alteration of pRB in sarcomatous component.
18459177 The current findings demonstrated that loss of Rb and p16/INKa expression and high E2F1 expression indicate impairment of the Rb suppressor pathway
18458534 Human breast cancer-associated fibroblasts show CAV1 down-regulation and RB1 tumor suppressor functional inactivation.
18431743 Meta-analysis of gene-disease association. (HuGE Navigator)
18391203 MRPS18-2 binds to both hypo- and hyperphosphorylated forms of Rb protein specifically. This binding targets the small pocket of pRb, which is a site of interaction with E2F1.
18386058 tumorigenesis of RMS may be associated with retinoma gene alteration
18383208 Increased retinoblastoma 1 expression was associated with invasive adenocarcinoma of the prostate
18381962 The absence of pRB expression renders human breast cancer cells more sensitive to 5-FU and methotrexate and predicts a good clinical outcome for patients treated with adjuvant chemotherapy
18360108 reduced expression of PNUTS leads to activation of Rb-phosphatase and caspase-mediated apoptosis
18348166 Results suggest that Bin1 gene suppression caused by oncogenic E1A via Rb/E2F1 inactivation is an essential step in cell cycle progression promoted by c-Myc, and subsequently, E1A transformation.
18332869 Rb antagonizes gankyrin to inhibit MDM2-mediate p53 ubiquitination in cancer cells and suggest that the status of both p53 and Rb is important for efficacy of cancer chemotherapy.
18321963 We concluded from these studies that both UL97 kinase activity and the LxCxE retinoblastoma protein (RB) binding motif are required for the phosphorylation and stabilization of RB in infected cells.
18306932 Analysis of the pattern of expression of these biomolecules showed increased p16-positive phenotypes and decreased cyclin D1- and pRB-positive phenotype among the invasive tumors compared to low-grade CIN lesions
18305152 Cdk6 up-regulation in TDP-43-depleted cells is accompanied by an increase in phosphorylation of two of its major targets, the retinoblastoma protein pRb and pRb-related protein pRb2/p130.
18296270 The morphology and cell cycle proteins immunoexpression of the novel probable preinvasive lesion - bronchiolar columnar cell dysplasia (BCCD), is decribed.
18294958 Our data suggest that p107 and p130, but not pRb, and the repressor E2F, but not activator E2Fs, play a critical role in regulating E2F-responsive gene expression.
18281541 Observational study of gene-disease association. (HuGE Navigator)
18262051 The deletion of the RB1 gene plays an important role in the development of acute myelocytic leukemia.
18236071 Findings strongly demonstrate that retinoblastoma (RB) and cyclin-dependent kinase 2 (CDK2) on one side and cytokeratin 8 (CK8) and epidermal growth factor receptor 2 (HER2) on the other may affect the clinical course of the disease in 56% of patients.
18216119 These findings indicate that Epstein-Barr virus C promoter (Cp) is a cell cycle-regulated promoter that is under the control of Rb and the histone demethylase LSD1 in multiple latency types.
18211953 Loss of both RB1 tumor suppressor gene alleles initiates quiescent RB1(-/-) retinomas with low level genomic instability and high expression of the senescence-associated proteins p16(INK4a) and p130.
18196971 In this review, retinoblastoma protein acts along with Skp2 to regulate signal transduction in the cell cycle.
18181215 analyzed RNA from retinoblastoma patients and unaffected carriers with various RB1 gene mutations to determine the patterns of missplicing and associations with phenotypic expression
18073205 defines a novel family of cellular factors linked to cell proliferation and pRb/E2F cell cycle pathways in humans, fish, and nematodes
18071317 RB inactivation, via aberrant nucleocytoplasmic transport, may disrupt normal cell differentiation programs and accelerate the cancer process.
18048012 These data shed more light on the molecular biology of meningioma cells and suggest that survivin and proteins of the RB pathway could play a determinant role in the development and the treatment of meningiomas.
18000883 Study described the use of minigene constructs to study the oncogenic character of intronic RB1 variants detected during mutational screening and show the utility of this approach to ascertain the oncogenic nature of unique RB1 intronic variants.
17996702 The crystal structure of the Rb N-terminal domain (RbN) was determined.
17991896 underline the importance of Protein phosphatase 2A subunit PR70-Ca(2+) interaction in the signal transduction mechanisms triggered by redox imbalance and leading to pRb dephosphorylation
17977825 Calpain emerges as a central player in E7-mediated degradation of Rb
17974914 A novel molecular mechanism for pRb inactivation by a viral oncoprotein.
17963824 mechanisms other than RB1 gene changes may lead to retinoblastoma because not all cases of retinoblastoma show gene alterations
17960112 Ten novel mutations were identified, including four single base substitutions, four small deletions and two small duplications. Predominantly gene-inactivating mutations, i.e. single-base non-sense mutations and splice site mutations.
17916908 compromise of either p53 or Rb pathways during melanocyte transformation leads to up-regulation of survivin expression in melanoma
17913805 Human herpesvirus 6A (HHV-6A) and HHV-6B infection was associated with significant reduction of E2F1/Rb complexing, and Rb protein was dephosphorylated early postinfection.
17913706 Myc down-regulation is a mechanism to activate the Rb pathway in STAT5A-induced senescence
17900658 There is more frequent p16 hypermethylation in mantle cell lymphoma and p15 or Rb1 hypermethylation in follicular lymphoma
17880527 Somatic down-regulation of mismatch repair proteins in nodular-trabecular muscle-invasive bladder urothelial carcinomas results in RB1/NF1 microsatellite abnormalities, correlating with higher cellular turnover and longer survival.
17877762 High mobility group protein A1 (HMGA1)disturbs retobblastoma protein-mediated cell arrest, suggesting a negative control of RB by HMGA1.
17804741 Retinoblastoma deficiency increases chemosensitivity in lung cancer.
17716930 It is recorded that borealin is a cell cycle regulator, down-regulated in response to p53/Rb-signaling, and up-regulated in many types of cancerous tissues.
17704056 KAP1 contributes to the negative regulation of E2F1 and may serve as a partial backup to prevent E2F1-mediated apoptosis in the absence of pRb
17702869 homozygous inactivation of P2RY5 was antecedent to the loss of RB1 during tumor development
17695524 Aberrations of the p53, Rb and p27 pathways are associated with aggressive clinical behavior in DLBCL.
17686574 ectopically BRCA2-expressing cells have different intracellular levels of Aurora A, Aurora B, p21, E2F-1, and pRb, suggesting a BRCA2-mediated suppression of polyploidy via stabilization of the checkpoint proteins levels
17671693 retinoblastoma protein downregulation is involved in the enhanced cytotoxicity of 4-hydroxytamoxifen plus mifepristone combination therapy versus antiestrogen monotherapy of human breast cancer
17652530 Aberrant methylation of multiple genes (E-cadherin, estrogen receptor, RB1 , p16, p15, p14, and MGMT) is involved in gastric carcinogenesis.
17642181 correlation between RB1 gene deletion and mammary gland carcinoma
17640669 RB reconstitution into RB-deficient NSCLC lines establishes regulation of certain RB/E2F target genes and restores G1 arrest mechanisms
17616676 RB depletion dramatically alters the cellular response to therapeutic intervention in prostate cancer cells
17616526 RbAp48-mediated transformation of HPV16 is probably because of the regulation by RbAp48 of tumor suppressors retinoblastoma and p53, apoptosis-related enzymes caspase-3 and caspase-8, E6, E7, cyclin D1 (CCND1), and c-MYC.
17609271 the HPV16 E7-associated cullin 2 ubiquitin ligase complex contributes to aberrant degradation of the pRB tumor suppressor in HPV16 E7-expressing cells.
17597480 Epstein-Barr virus-encoded latent membrane protein 1inhibited p16(INK4A) expression, promoted phosphorylation of p105 Rb and upregulated E2F1 expression and overexpression of E2F1 alone was sufficient to upregulate telomerase activity.
17576813 Results identify BNIP3 as a key regulator of hypoxia-induced autophagy and suggest a novel role for the RB tumor suppressor in preventing nonapoptotic cell death by limiting the extent of BNIP3 induction in cells.
17557897 Down-regulation of Rb Protein is associated with defects in erythroblast islands
17549378 Inactivation of retinoblastoma protein is associated with head and neck squamous cell carcinomas
17523078 Promoter hypermethylation of RB1 was observed.
17511743 A microtuble-facilitated nuclear import pathway for RB1 is described.
17495525 sufficient Rb levels are important for the cytotoxic and anticlonogenic effects of ErPC3 at levels below the IC(50), but higher concentrations of ErPC3 are less dependent on Rb status
17490733 In Ishikawa H cells that model type I endometrial cancer in the loss of PTEN and RB1, re-expressing PTEN and RB1 increased the apoptotic and G1 phases and decreased the S and G2-M phases, which further sensitize the cells to gefitinib.
17461478 Abnormal expression of the pRB protein may be implicated in the process of esophageal carcinogenesis.
17455244 these analyses demonstrate that cyclin A1 exerts antiapoptotic functions by interacting with retinoblastoma and Ku proteins in leukemia cells.
17428253 Telomere dysfunction and inactivation of the rb pathway might play a role for pyrothorax-associated lymphoma
17413032 SARS-CoV 3a protein, through limiting the expression of cyclin D3, may inhibit Rb phosphorylation, which in turn leads to a block in the G1 phase of the cell cycle and an inhibition of cell proliferation
17390023 LOH of the retinoblastoma gene in is not shown to have a role in progression of osteosarcoma
17380128 Phosphorylation of pRB at Ser612 by Chk1/2 leads to a complex between pRB and E2F-1 after DNA damage.
17369843 Radiation-induced somatic mutations are not observeded in radiation-induced sarcoma, although the gene was activated in sarcoma.
17369289 TGF-beta1 increased retinoblastoma protein phosphorylation at both Ser807/811 and Ser780 in airway smooth muscle cells
17332242 RB1 may be inactivated in aggressive mantle-cell lymphoma by intragenic deletions.
17318405 Presence of LOH at the RB1 gene locus and the increased levels of RB1 RNA and protein and increased percentage of hyperphosphorylated form of pRb are indicative of an overall deregulation of pRb pathway in human brain tumors.
17299438 This is the first report of a deep intronic mutation in RB1 and is a proof of concept that some undetected RB1 mutations should be investigated at the cDNA level.
17297463 This study demonstrates that ARF plays a direct role in regulation of Rb and suggests that inactivation of ARF may lead to defects in both p53 and Rb pathways in human cancer development.
17286450 Sequence deletion or mutation or gene deletion in retinoblastoma patients in Argentina.
17216555 aberrant hypermethylation of the key cell cycle regulatory genes occurs at a relatively high frequency in pituitary adenomas, especially in RB1 pathway genes with promoter hypermethylation of the p16(INK4a) gene being the most common deregulation
17183714 The growth suppression function of RB requires a conserved A/B domain that contains two distinct binding pockets. At the A/B interface is a binding site for the C-terminal trans-activation domain of E2F. The B-domain has a binding site for the LxCxE motif
17182682 Human papillomavirus E7 repression in cervical carcinoma cells initiates a transcriptional cascade driven by the retinoblastoma family, resulting in senescence.
17163992 Rb induces a proliferative arrest and regulates Brn-2 expression in retinoblastoma cells
17160137 RB pathway is a critical determinant of tumorigenic proliferation and differential therapeutic response and may represent a critical basis for directing therapy in the treatment of breast cancer.
17145812 The pRb level was higher than in normal larynxes, whereas laryngeal cancer presented the lowest levels.
17131485 mutation of Rb gene is frequent in gastric carcinoma; expression of altered protein inversely correlates with tumor invasion
17094467 Promoter methylation of retinoblastoma Protein is associated with malignant fibrous histiocytomas
17047088 Observational study of gene-disease association. (HuGE Navigator)
17043357 significant cytoplasmic mislocalization of ordinarily nuclear RB in cells harboring Cdk4 mutations
17031475 Data suggest that in Ehrlich ascites tumor cells, growth inhibition by 1'-acetoxychavicol acetate involves decreased Rb and p27(kip1) phosphorylation and increased nuclear localization of p27(kip1), dependent on cellular thiol status.
17028578 Results uncover an unexpected role for the p16(INK4a)-Rb pathway and provide a new insight into how senescent cell-cycle arrest is enforced.
17012228 p53 and pRB can be sumoylated by SUMO-2/3 in vivo, and such modification of p53 and pRB may play roles in premature senescence and stress response
16984923 CDCA4 participates in the regulation of cell proliferation, mainly through the E2F/retinoblastoma protein pathway
16966377 these studies highlight p38 MAPK, HBP1, and RB as important components for a premature-senescence pathway with possible clinical relevance to breast cancer.
16948516 Determination of intraepithelial height of immunohistochemical staining for p16, p53, pRb, and Ki-67 in upper aerodigestive tract lesions with reference to degree of dysplasia
16936805 The antiproliferative effects of Lf can likely be attributed to the elevated levels of hypophosphorylated Rb.
16935576 nonphosphorylated p68 inhibited the stimulation of pol-alpha activity by hyperphosphorylated retinoblastoma protein, suggesting that p68 might impede the association of ppRb with p180
16916716 The transformation of melanocytes to melanoma cells is characterised by abnormal proliferation due to cell cycle alterations. This occurs through alterations in the retinoblastoma (Rb) and p53 tumour suppressor pathways.
16912184 Relationship between Rb and Ini1 in tumor suppression indicate that Ini1 plays a role in maintaining the morphologic and functional differentiation of corticotrophic cells.
16880741 These findings reveal that phosphorylation of threonine-373 by CDK2-cyclin E represent a potentially crucial event in the inactivation of the pRb protein.
16824683 Membrane depolarization may stimulate cellular proliferation by augmenting the expression of cyclin E leading to increases in Cdk2 activity and RB phosphorylation in a neuroblastoma cell line.
16816134 facets of RB protein function in cell cycle control in retinoblastoma (review)
16764854 when nontransformed CV1 epithelial cells and Hs578T breast cancer cells are treated with cytosine arabinoside,Thr-821 of Rb is rapidly dephosphorylated,with dissociation of the PP1 regulatory subunit PNUTS (phosphatase nuclear targeting subunit)from PP1.
16698799 intracellular distribution of nucleolin in epithelial cells is Rb-dependent, and an altered nucleolin localization in human cancerous tissues results from a loss of Rb
16685266 Observational study of gene-disease association. (HuGE Navigator)
16682285 A molecular study of first and second RB1 mutational hits in retinoblastoma patients was performed.
16682076 RB1 gene was methylated in seven samples (14%) and each patient had refractory anemias(RA).
16619045 determination that Rb is not activated in hTERT immortalization of urothelial cells
16616093 Differences in oncoprotein expression between endometriotic and adenomyotic tissues provide further evidence that the pathogenesis of endometriosis is different from that of adenomyosis.
16614728 These findings suggest heterogeneous abnormalities of CCND and RB in cutaneous T-cell lymphomas, in which dysregulated CCND and RB1 may lead to impaired cell cycle control.
16595082 Observational study of genotype prevalence. (HuGE Navigator)
16570290 Our data suggests that RB1 may play a role in colorectal tumorigenesis through functional regulation of the transcript and protein rather than through its tumour suppressor role by gene inactivation.
16464825 Possible role for the G-quadruplex in control of DNA synthesis at the 5' end of the retinoblastoma susceptibility gene.
16388084 RB1 was not implicated, suggesting the participation of another tumor suppressor gene in this region.
16368535 Rb binding to HPV 18 E7 is modified by transglutaminase 2 with different polyamines
16360038 Findings explain the requirement of the Rb C-terminal domain for high-affinity E2F binding and growth suppression, and establish a mechanism for the regulation of Rb-E2F association by phosphorylation.
16354195 Clear need in human melanoma cell lines to disrupt both RB and p53 pathways and recurrent mechanisms which play into the unique genetic vulnerabilities of this tumor type.
16352731 EBNA3C forms a stable complex with Rb in cells when the proteasome machinery is inhibited and interacts with Rb in vitro, mapping to a conserved domain at the terminus of EBNA3C
16343421 These findings suggest that overexpression of Mdm2 can perturb a RB pathway regardless of the p53 gene status, promoting carcinogenesis.
16332962 Down-regulation of the retinoblastoma tumor suppressor by the hepatitis C virus NS5B RNA-dependent RNA polymerase.
16315642 Review. RB1 is a marker of retinoblastoma. It maps to 13q14.2 & encodes a 110-kDa nuclear phosphoprotein, cell-cycle-regulated phosphorylation of which plays a major role in cell proliferation control. Most point mutations are in exons 3, 8, 18 & 20.
16303160 Sars virus 7a protein expression was correlated with phosphorylation of retinoblastoma (Rb) protein at ser795 and ser809/811 and prevention of cell cycle progression at the G0/G1 phase.
16286473 DGKzeta may act in vivo as a downstream effector of pRB to regulate nuclear levels of diacylglycerol and phosphatidic acid
16273238 RB expression may be a useful biomarker for assessing the risk of developing esophageal cancer.
16269091 Meta-analysis of gene-disease association. (HuGE Navigator)
16254459 Methylation in the p16 promoter region is biologically significant, being associated with phosphorylation of pRb and cell growth in human hepatocellular carcinoma cells
16212876 pRB degradation involved in gastric tumor cell apoptosis is p53-independent
16205627 results show that phosphorylation site-mutated RB exerts disparate effects on apoptotic response to different stimuli, and that cell cycle arrest does not always associate with resistance to apoptosis
16188218 data show that E2F1 has potential binding activity to the retinoblastoma control element and a different transcriptional regulation pathway which cooperates with the retinoblastoma tumor suppressor protein
16186801 data suggest that loss of Rb creates strong selective pressure, via DSB accumulation, for inactivating p53 mutations and that E2F1 contributes to the genetic instability associated with transformation and tumorigenesis
16127685 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16127685 Gross deletions and insertions in the RB1 gene are associated with retinoblastoma.
16042572 Modulates the subcellular localization of BAG-1 in colorectal tumor cell susrvival.
16020958 Deregulation of both pRb and p53 pathways is associated with malignant transformation in oral tumorigenesis
15939381 developmental expression of RB, p130 and p107 in mouse and human retina
15884040 Germline RB1 mutations in 77 out of 85 bilateral RB patients (91%), 7 out of 10 familial unilateral (70%), and 6 out of 85 unilateral patients with no family history of RB (7%), were identified.
15881662 RB1 gene has a major role in the development of human vestibular schwannomas, increased levels of RB1 mRNA, total pRb and the phosphorylated form of it suggests that RB1 gene in these tumors may have anti-apoptotic function
15878620 The Aberrant expression of Rb Genes were determined in bone marrow samples of children with de novo B-lineage (n=170) and T-lineage (n=25) acute lymphoblastic leukemia (ALL).
15838894 nuclear import conferred by the RB nuclear localization sequence has distinct properties, in part due to the affinity of its interaction with IMPalpha
15827088 p130/p107/p105Rb has a role in transcriptional repression in DNA-damage-induced cell-cycle exit at G2
15811853 Smad7 acts to functionally inactivate RB and de-repress E2F without blocking the activation of TbetaRI and the nuclear translocation of Smad2/3, allowing TGF-beta1 to exert effects in a cancer cell that is resistant to TGF-beta1-mediated growth inhibition
15809752 RB gene might be down-regulated at the transcriptional level in human testicular seminoma cells.
15776430 the RB1 gene is conserved in human and primates
15767262 Rb enhances the POMC promoter activation by the CRH hormone in mouse AtT-20 corticotroph cells
15767262 Rb acts as a coactivator of HNF-4 and is recruited to the alpha1-AntiTrypsin promoter during the enterocyte differentiation of Caco2 cells
15767262 Rb potentiates the activity of the SRC-2/GRIP1/TIF-2, SRC-1 and SRC-3 coactivators on the nuclear receptors: NGFI-B/Nur77, Nur1, NOR-1, HNF-4, SF-1 and ER.
15767262 Rb interacts with the nuclear receptors : NGFI-B/Nur77, HNF4, SF-1, and ER and enhances their activity during hormone responsivness and cell differentiation
15767262 Rb interacts with and acts as a potentiator of the p160 transcriptional coactivator SRC-2/GRIP1/TIF-2
15763650 Observational study of gene-disease association. (HuGE Navigator)
15763542 Knockdown of the gene in colorectal carcinoma cells caused resistance to antitumor agents.
15752352 Dehydroepiandrosterone diminished the levels of phosphorylated retinoblastoma protein.
15741232 an early event in neuronal cell death is p25/Cdk5-mediated retinoblastoma phosphorylation
15731778 Data showed that disabling of the Rb pathway was frequent event in oral carcinoma.
15716956 Mitf-mediated activation of p21Cip1 expression and consequent hypophosphorylation of Rb1 will contribute to cell cycle exit and activation of the differentiation programme
15709169 Suppression of pRb may be characteristic for papillary thyroid carcinomas with a tendency to early metastasizing.
15701640 Rb is a coactivator of NeuroD1/Beta2 on the POMC promoter
15701640 Rb interacts with the NeuroD1/Beta2 transcription factor and activates the POMC gene
15684604 experiments suggest that both catalytic and non-catalytic functions of cyclin D1 can collaborate to inactivate pRb-mediated cell cycle exit
15679863 an alternatively translated form of pRb is expressed during normal myelopoiesis and in tumour-associated macrophages
15674338 a functional interaction between pRB and HIF-1alpha is confirmed by showing that HIF-1alpha reverses the transcription repressor function of pRB.
15671551 Rb and p53 have roles in progression of primary non-small cell lung carcinoma
15655836 Mutation of p16 and Rb genes might be correlated with progression of gallbladder carcinoma
15647840 BMP-2 inhibits DHT-induced growth of LNCaP cells through a decrease in E2F protein expression and suppression of E2F activity by hypophosphorylation of Rb
15647383 Rb, p21Cip1, and PCNA have roles in cAMP-mediated inhibition of DNA replication and S phase progression
15640164 the derepression of Rb-E2F-regulated genes leads to apoptosis through inactivation of focal adhesion kinase and activation of caspase-8
15580311 a model whereby Tax targets Rb to the proteasome by acting as a molecular bridge bringing Rb into contact with the proteasome for degradation
15577944 These results suggest that Mdm2 regulates function of retinoblastoma gene product (pRB) via ubiquitin-dependent degradation of pRB.
15564485 phosphorylation promoted by HPV16 E6 protein
15547691 p16-Rb pathway plays important role in tumor progression and prognosis in vertical growth phase melanomas
15523694 Observational study of gene-disease association. (HuGE Navigator)
15502804 Evaluation of phosphorylated retinoblastoma protein in melanocytic tumors could become a helpful adjunct in clinicopathological routine.
15492985 Aberrant expression of pRb and p16, alone and in combination, heralds poor prognosis in patients with CRC.
15485920 Raf-1 links mitogenic signaling to Retinoblastoma Protein and that disruption of this interaction could aid in controlling proliferative disorders
15485814 the central acidic domain of MDM2 is critical in inhibition of retinoblastoma-mediated suppression of E2F and cell growth
15469703 Constitutional RB1 germ-line mutations were studied in a series of Argentine families.
15467457 dynamic equilibrium between CDKs and PP2A modulates phosphorylation of pRB
15389598 p21(WAF1), acting through the phosphorylation of pRb, regulates whether 2BS cells cease to proliferate and become senescent but resistant to apoptosis, or whether they accelerate proliferation while becoming more susceptible to apoptotic stimuli
15389561 Results demonstrate that p16ink4A-mimicking peptides can induce apoptosis in vitro and inhibit tumor growth in vivo in p16-defective, retinoblastoma protein-expressing human melanoma cells.
15381253 RB/E2F signaling pathway activation is required for the modulation of hepatitis C virus core protein-induced cell growth in liver and non-liver cells
15367600 herpesvirus saimiri (HVS) ORF73 binds both p53 and pRb in vitro and in vivo, colocalizes with p53 in T cells infected with HVS, and in cells overexpressing both ORF73 and p53, and adversely influences pRB/E2F and p53 transcriptional regulation
15308640 Immortalization of MRC5hTERT cells was associated with repression of the cyclin-dependent kinase inhibitor p16INK4a and up-regulation of pRB.
15306814 Generation of Rb pathway lesions in normal and transformed cells produces aberrant Mad2 expression and mitotic defects leading to aneuploidy, such that elevated Mad2 contributes directly to these defects
15264269 Hereditary retinoblastoma is an autosomal dominant disorder caused by mutations in the RB1 gene [Review]
15210709 Rb acts as a link between apoptotic and proliferative pathways by interacting with distinct kinases and occupying different promoters
15199152 RB can repress U6 snRNA gene transcription at critical steps subsequent to RNA polymerase III recruitment
15193257 In mice, Rb/p107 loss has cell-specific effects in retina: evidence for a naturally death resistant cancer cell-of-origin
15169919 A novel Cdk4 docking motif has been defined within a stretch of 19 amino acids from the C-terminal domain of the Rb protein that are essential for Cdk4 binding.
15162822 Observational study of genotype prevalence. (HuGE Navigator)
15161658 Rb is absent or phosphorylated in most anaplastic large cell lymphoma cell lines and tumors and absence of Rb expression is associated with better clinical outcome in patients with ALCL.
15105429 Data show that Oct-1 occupies the endogenous HLA-DRA promoter when the HLA-DRA promoter is inactive in retinoblastoma protein-defective cells.
15103018 Expression of HIV-1 Tat upregulates the abundance of retinoblastoma 1 (RB1) in the nucleoli of Jurkat T-cells
15093750 Expression of HIV-1 Tat upregulates the abundance of retinoblastoma 1 (RB1) in the nucleoli of Jurkat T-cells
15084261 A non-cdk8-associated cellular pool of cyclin C combines with cdk3 to stimulate pRb phosphorylation at S807/811 during the G0/G1 transition, and this phosphorylation is required for cells to exit G0 efficiently.
15048095 Rb regulates apoptotic genes differently in human and in mouse cells
15044952 Results suggest that acetylation regulates the differentiation-specific function(s) of retinoblastoma tumor-suppressor protein.
14966529 The mechanisms for pRb tumor suppression in the epithelia of two distinct tissues, mammary gland and brain, are indistinguishable. (review)
14871261 The overall expression of PCNA in all stages of development was higher than pRb1 expression.
14737116 role of Rb family memebers in stability of repressor complexes at promoters
14732703 pRb and p107 do not constitute the last control point for extracellular factors during G(1)-phase progression, and they functionally separate the requirements for serum and cell anchorage in terms of involved cell cycle components.
14730602 Rb negatively regulates p38 activation, leading to decreased MMP-1 secretion in rheumatoid arthritis synovial fibroblasts.
14729647 Calcitrio may signal cell differentiation of HL 60 cells which in turn regulates expresson of RB protein.
14722923 Observational study of genetic testing. (HuGE Navigator)
14722923 Fortythree novel mutations found in RB1, the mutational spectrum displayed a surprising amount of splice mutations and large deletions.
14693709 Rb is present in rat and human islets, and overexpression of cyclin D(1)/cdk-4 led to strikingly enhanced Rb phosphorylation.
14681231 results establish that tumor necrosis factor alpha targets insulin-like growth factor-I induced E2F-transcription facor 1 synthesis, leading to inhibition of accumulation in cyclin A and hyperphosphorylation of RB protein
14676836 Androgens repress Bcl-2 expression via activation of RB in prostate cancer cells.
14645241 Rb and ASC-2 have roles in androgen receptor transactivation
14631100 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14585976 kinetic framework of RB tumor suppressor action in transcriptional repression and cell cycle regulation
14534726 cell lines lacking an active RB gene are more resistant than cell lines with an active RB gene
14533007 RB1CC1 induces the expression of RB1, especially of underphosphorylated forms, then suppresses cell cycle progression in human neoplastic cells
14519639 The survival data on 129 glioblasstoma patients were correlated with the results of a detailed analysis of this gene.
12963997 p21WAF1/CIP1, pRB, Bax and NF-kappaB have roles in induction of growth arrest and apoptosis by resveratrol in tumor cell lines
12947005 C/EBPepsilon interacts with Rb and E2F1 during granulocytic differentiation
12944478 These results indicate that PAI-2 may enhance Rb's tumor suppressor activity and suggest a potential therapeutic role for PAI-2 against HPV-transformed lesions.
12860972 EBV LMP1 blocks p16INK4-RB pathway by promoting nuclear export of E2F-4 and E2F-5.
12809602 Senescence-associated heterochromatic foci formation coincides with the recruitment of heterochromatin proteins and the retinoblastoma (Rb) tumor suppressor to E2F-responsive promoters and is associated with the stable repression of E2F target genes.
12629508 We found that E2F1 was present at most of the CpG islands bound by pRb, independent of the phase of the cell cycle, our data suggest that the majority of DNA-bound pRb is recruited to E2F target promoters during both G(0)/G(1) and S phases.
12621062 report shows hypophosphorylation of the retinoblastoma family proteins induced by H2O2 was because of the activity of protein phosphatase 2A and pRb dephosphorylation may induce an intra-S-phase response that leads to a reduced rate of DNA synthesis
12594215 retinoblastoma protein has cyclin D1-inducing activity that is abolished by adenovirus E1A and that involves multiple pocket sequences that are independently involved in cyclin D1 activation
12588990 p55gamma binds to Rb and modification of this association can lead to cell cycle arrest
12569181 first preimplantation genetic diagnosis of hereditary retinoblastoma using microsatellite markers of this protein
12556968 RB1 CpG island hypermethylation is a common epigenetic event that is associated with the development of malignant nervous system tumours.
12532471 Expression of p57kip2, Rb protein and PCNA and their relationships with clinicopathology in human pancreatic cancer.
12528819 Rb and its inactive phospho-isoform exhibit distinct expression patterns in Parkinson disease neurons most commonly associated with the disease, as well as in neurons elsewhere in the brain that also contribute to disease progression or symptoms.
12508351 Results describe the relationship between Helicobacter pylori (H.pylori) infection and the expressions of the p53, Rb, c-myc, bcl-2 and hTERT mRNA in a series of diseases from chronic gastritis to gastric cancer.
12507935 inactivation of both p16(INK4a) and pRb is associated with immortalization of human cells including fibroblasts and epithelial cells and telomerase-positive cells and ALT-positive cells
12499093 The relationships and interactions between p53, Rb and bcl-2 immunostaining, clinical parameters and response to cisplatin-based chemotherapy were evaluated in the present study.
12475961 data suggest that hypophosphorylated Rb is anchored in the nucleus by the interaction of pocket C with LAP2alpha-lamin A/C complexes
12461781 pRB has a role in eye cancer [review]
12459729 REVIEW: The retinoblastoma tumour suppressor in development and cancer
12419581 novel mutations in Mexican patients with retinoblastoma: SSCP sequence showed new non-described mutations that produced a frameshift on the open reading frame
12401721 Activation of cyclin D1-Cdk4 and Cdk4-directed phosphorylation in diabetic mesangial hypertrophy
12391839 Aberrant methylation inactivating RB1 was detected in 14 (27%) tumors.Complex testing for RB1 mutations, loss of heterozygosity, and functional inactivation of the two genes revealed a molecular defect in at least one allele in 51 (98%) tumors.
12391156 Data show that the retinoblastoma protein specifically activates transcription of the survival gene bcl-2 in epithelial cells but not in NIH 3T3 mesenchymal cells.
12377414 Gene aberrations at chromosome 13 are involved in the progression of laryngeal squamous cell carcinoma; results provided further evidence for the putative role of the RB1 gene alterations in the metastatic process
12374284 Review. Rb suppresses tumor formation through its multiple biological activities. A theme throughout its multiple cellular functions is its central role in controlling activities that involve chromatin remodeling. Rb may control global genome fluidity.
12362308 Low-penetrance retinoblastoma due to exons 24 and 25 deletions in the Rb1 gene
12241561 Expression of HIV-1 Tat upregulates the abundance of retinoblastoma 1 (RB1) in the nucleoli of Jurkat T-cells
12197776 Localization and phosphorylation kinetics of this protein correlate with the cellular phenotype of cultured breast adenocarcinoma cells.
12173465 The spectrum and frequencies of RB1 structural defects were studied in tumors and peripheral blood lymphocytes of patients with various forms of retinoblastoma
12153616 Expression of RB C pocket fragments in HSF induces delayed cell cycle progression and sensitizes to apoptosis upon cellular stresses.
12145697 pRB expression and function are normal in 63 of 66 NHL cases, including 12 of 13 lymphomas with loss of one RB1 allele.There was no association between pRB expression/RB1 copy number and apoptotic fraction.
12140374 The alpha-MSH-induced differentiation of COLO 853 human melanoma cells is associated with decreased pRB phosphorylation and accumulation of cells in the G(1) phase.
12096344 The cyclin D1 high and cyclin E high subgroups of breast cancer: separate pathways in tumorogenesis based on pattern of genetic aberrations and inactivation of the pRb node.
12085226 Lack of functional pRb results in attenuated recovery of mRNA synthesis and increased apoptosis following UV radiation in human breast cancer cells.
12054658 Oxidized low density lipoprotein induces the cyclin-dependent kinase inhibitor p21(waf1) and the tumor suppressor Rb.
12032846 Human telomerase accelerates growth of lens epithelial cells through regulation of the genes mediating RB/E2F pathway
12021356 Three regions of the pRB pocket domain affects its inactivation by human papillomavirus E7 proteins in Hela cells
12016586 A parent-of-origin effect in two families with retinoblastoma is associated with a distinct splice mutation in the RB1 gene.
11971966 Results show that Tax directly interacts with CDK4. The Tax/CDK complex represents an active holoenzyme which capably phosphorylates the Rb protein in vitro and is resistant to repression by the inhibitor p21(CIP).
11960384 Activation of caspase-3 and cleavage of Rb are associated with p16-mediated apoptosis in human non-small cell lung cancer cells.
11956626 Allelic deletions of Rb in urine from bladder cancer patients
11940667 Tumor suppression by a severely truncated species of retinoblastoma protein
11832063 Observational study of gene-disease association. (HuGE Navigator)
11788883 Suppression of tumorigenicity of rat liver tumor cells by human chromosome 13: evidence against the involvement of pRb and BRCA2
11668642 novel mutations found in Polish patients with familial and/or bilateral retinoblastoma
11568901 Observational study of genetic testing. (HuGE Navigator)
11524739 K616E in exon 19 (c.1846A>G), an AA insertion in exon 7 (c.684-685insAA), R500G in exon 16 (c.1498A>G), and an A insertion in exon 23 (c.2391-2392insA).
9632747 Rb is a coactivator of AP-2 in epithelial cells
9632747 Rb interacts with the AP-2 transcription factor and activates the E-cadherin gene expression
9525916 Expression of HIV-1 Tat upregulates the abundance of retinoblastoma 1 (RB1) in the nucleoli of Jurkat T-cells
9453249 Expression of HIV-1 Tat upregulates the abundance of retinoblastoma 1 (RB1) in the nucleoli of Jurkat T-cells
8490568 Expression of HIV-1 Tat upregulates the abundance of retinoblastoma 1 (RB1) in the nucleoli of Jurkat T-cells
7777526 E2F target genes display elevated levels in Rb-/- MEFs. Absence of functional Rb is sufficient for S-phase entry under growth-limiting conditions, indicating that the E2F complexes containing Rb protein may be rate limiting for the G1/S transition.

AA Sequence

MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHV      1 - 70
RERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDT     71 - 140
STKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMED    141 - 210
DLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKE    211 - 280
HECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDS    281 - 350
FETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK    351 - 420
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACA    421 - 490
LEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMES    491 - 560
LAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAET    561 - 630
QATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHL    631 - 700
DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQ    701 - 770
YASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG    771 - 840
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTR    841 - 910
MQKQKMNDSMDTSNKEEK                                                        911 - 928
//

Text Mined References (869)

PMID Year Title
27012093 2015 [RELATIONSHIP BETWEEN p53/p21/Rb AND MAPK SIGNALING PATHWAYS IN HUMAN ENDOMETRIUM-DERIVED STEM CELLS UNDER OXIDATIVE STRESS].
26928463 2016 Substantial interindividual and limited intraindividual genomic diversity among tumors from men with metastatic prostate cancer.
26925970 2016 A Parent-of-Origin Effect Impacts the Phenotype in Low Penetrance Retinoblastoma Families Segregating the c.1981C>T/p.Arg661Trp Mutation of RB1.
26810492 2016 LINE-1 silencing by retinoblastoma proteins is effected through the nucleosomal and remodeling deacetylase multiprotein complex.
26783196 2016 Phosphorylated retinoblastoma protein is a potential predictive marker of irinotecan efficacy for colorectal cancer.
26718407 2016 CBX8 antagonizes the effect of Sirtinol on premature senescence through the AKT-RB-E2F1 pathway in K562 leukemia cells.
26713361 2016 Evodiamine selectively targets cancer stem-like cells through the p53-p21-Rb pathway.
26711265 2015 The N Terminus of the Retinoblastoma Protein Inhibits DNA Replication via a Bipartite Mechanism Disrupted in Partially Penetrant Retinoblastomas.
26708419 2016 The anti-diabetic drug metformin inhibits pancreatic cancer cell proliferation in vitro and in vivo: Study of the microRNAs associated with the antitumor effect of metformin.
26677227 2016 Ras Regulates Rb via NORE1A.
26676380 2016 RBEL1 is required for osteosarcoma cell proliferation via inhibiting retinoblastoma 1.
26647789 2016 Differential regulation and synthetic lethality of exclusive RB1 and CDKN2A mutations in lung cancer.
26598524 2016 The Retinoblastoma Tumor Suppressor Protein (pRb)/E2 Promoter Binding Factor 1 (E2F1) Pathway as a Novel Mediator of TGF?-induced Autophagy.
26566968 2016 The Spectrum of E2F in Liver Disease--Mediated Regulation in Biology and Cancer.
26548607 2016 UHRF1 promotes human osteosarcoma cell invasion by downregulating the expression of E?cadherin in an Rb1?dependent manner.
26539030 2015 Spectrum of germ-line RB1 gene mutations in Malaysian patients with retinoblastoma.
26442585 2015 A Novel Retinoblastoma Protein (RB) E3 Ubiquitin Ligase (NRBE3) Promotes RB Degradation and Is Transcriptionally Regulated by E2F1 Transcription Factor.
26397460 2015 OTX2 is a therapeutic target for retinoblastoma and may function as a common factor between C-MYC, CRX, and phosphorylated RB pathways.
26396485 2015 Alterations in the RB1 gene in Pakistani patients with retinoblastoma using direct sequencing analysis.
26378180 2015 Deficiencies in Cellular Processes Modulated by the Retinoblastoma Protein Do Not Account for Reduced Human Cytomegalovirus Replication in Its Absence.
26360782 2015 Bradykinin inhibits oxidative stress-induced senescence of endothelial progenitor cells through the B2R/AKT/RB and B2R/EGFR/RB signal pathways.
26339389 2015 Expression of p16 and pRB in invasive breast cancer.
26319102 2015 Regulation of the retinoblastoma-E2F pathway by the ubiquitin-proteasome system.
26264229 2015 Knudson's hypothesis revisited in Indian retinoblastoma patients.
26243836 2015 Genetic determinants of FOXM1 overexpression in epithelial ovarian cancer and functional contribution to cell cycle progression.
26100623 2015 Molecular Determinants for the Inactivation of the Retinoblastoma Tumor Suppressor by the Viral Cyclin-dependent Kinase UL97.
26063518 2015 The bone marrow metastasis niche in retinoblastoma.
26058606 2015 Increased phosphorylation on residue S795 of the retinoblastoma protein in esophageal adenocarcinoma.
26043844 2015 Comparative analysis of Rb1, P16 and ER as diagnostic, prognostic and potential targets for therapeutic agents in ovarian epithelial tumors: an immunohistochemical study of 130 ovarian carcinomas.
26032781 2015 Association between human papillomavirus and Epstein - Barr virus DNA and gene promoter methylation of RB1 and CDH1 in the cervical lesions: a transversal study.
26009982 2015 Retinoblastoma protein promotes oxidative phosphorylation through upregulation of glycolytic genes in oncogene-induced senescent cells.
25999316 2015 Multiple conformations are a conserved and regulatory feature of the RB1 5' UTR.
25928201 2015 Targeted next generation sequencing of RB1 gene for the molecular diagnosis of Retinoblastoma.
25818292 2015 Direct involvement of retinoblastoma family proteins in DNA repair by non-homologous end-joining.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25758528 2015 RB loss in resistant EGFR mutant lung adenocarcinomas that transform to small-cell lung cancer.
25712084 2015 Next generation sequencing in sporadic retinoblastoma patients reveals somatic mosaicism.
25694602 2015 The retinoblastoma tumor suppressor promotes efficient human cytomegalovirus lytic replication.
25684524 2015 RB1 polymorphism contributes to the efficacy of platinum-taxanes in advanced squamous cell lung cancer.
25675863 2015 The p16(INK4A)/pRb pathway and telomerase activity define a subgroup of Ph+ adult Acute Lymphoblastic Leukemia associated with inferior outcome.
25675300 2015 Pin1 inhibits PP2A-mediated Rb dephosphorylation in regulation of cell cycle and S-phase DNA damage.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25602518 2015 Mutation spectrum of RB1 gene in unilateral retinoblastoma cases from Tunisia and correlations with clinical features.
25579178 2015 A long non-coding RNA links calreticulin-mediated immunogenic cell removal to RB1 transcription.
25486431 2015 Antitumor mechanisms when pRb and p53 are genetically inactivated.
25483096 2014 Phosphorylation of the Retinoblastoma protein (Rb) on serine-807 is required for association with Bax.
25455074 2014 RB maintains quiescence and prevents premature senescence through upregulation of DNMT1 in mesenchymal stromal cells.
25451029 2014 The high-risk HPV16 E7 oncoprotein mediates interaction between the transcriptional coactivator CBP and the retinoblastoma protein pRb.
25446844 2014 Next-generation sequencing of salivary high-grade neuroendocrine carcinomas identifies alterations in RB1 and the mTOR pathway.
25444922 2015 The retinoblastoma (Rb) protein regulates ferroptosis induced by sorafenib in human hepatocellular carcinoma cells.
25424699 2015 Novel mutations in the RB1 gene from Chinese families with a history of retinoblastoma.
25368385 2015 Deregulation of Rb-E2F1 axis causes chromosomal instability by engaging the transactivation function of Cdc20-anaphase-promoting complex/cyclosome.
25348716 2015 PRMT4-mediated arginine methylation negatively regulates retinoblastoma tumor suppressor protein and promotes E2F-1 dissociation.
25305068 2014 Simultaneous silencing of multiple RB and p53 pathway members induces cell cycle reentry in intact human pancreatic islets.
25294902 2015 Genomic Alterations in the RB Pathway Indicate Prognostic Outcomes of Early-Stage Lung Adenocarcinoma.
25273089 2014 RABL6A promotes G1-S phase progression and pancreatic neuroendocrine tumor cell proliferation in an Rb1-dependent manner.
25266839 2014 Late-diagnosis retinoblastoma with germline mosaicism in an 8-year-old.
25252974 2014 Rb suppresses human cone-precursor-derived retinoblastoma tumours.
25223380 2014 Retinoblastoma tumor suppressor pathway in breast cancer: prognosis, precision medicine, and therapeutic interventions.
25218456 2014 Transfection of wtp53 and Rb94 genes into retinoblastomas of nude mice by ultrasound-targeted microbubble destruction.
25201325 2014 Human papillomavirus infection in Bowen disease: negative p53 expression, not p16(INK4a) overexpression, is correlated with human papillomavirus-associated Bowen disease.
25159481 2015 Linking ATM Promoter Methylation to Cell Cycle Protein Expression in Brain Tumor Patients: Cellular Molecular Triangle Correlation in ATM Territory.
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
25049398 2014 Lysine methylation-dependent binding of 53BP1 to the pRb tumor suppressor.
25046224 2014 Stepwise expression of CDKN2A and RB1 proteins in esophageal mucosa from patients at high risk for squamous cell carcinoma.
25028469 2014 Antiproliferative effects of CDK4/6 inhibition in CDK4-amplified human liposarcoma in vitro and in vivo.
25003838 2014 Biomarkers distinguishing mammary fibroepithelial neoplasms: a tissue microarray study.
24987858 2014 Reduced expression of the retinoblastoma protein shows that the related signaling pathway is essential for mediating the antineoplastic activity of erufosine.
24935581 2014 Tissue microarray immunohistochemical profiles of p53 and pRB in hepatocellular carcinoma and hepatoblastoma.
24919196 2014 A TRIP230-retinoblastoma protein complex regulates hypoxia-inducible factor-1?-mediated transcription and cancer cell invasion.
24913233 2014 Frequent disruption of the RB pathway in indolent follicular lymphoma suggests a new combination therapy.
24892564 2016 Hereditary Diffuse Infiltrating Retinoblastoma.
24888624 2014 Retinoblastoma (RB1) pocket domain mutations and promoter hyper-methylation in head and neck cancer.
24876129 2014 Cyclin D activates the Rb tumor suppressor by mono-phosphorylation.
24858910 2014 The survival gene MED4 explains low penetrance retinoblastoma in patients with large RB1 deletion.
24838394 2014 Deregulation of RB1 expression by loss of imprinting in human hepatocellular carcinoma.
24824777 2014 Retinoblastoma protein potentiates the innate immune response in hepatocytes: significance for hepatocellular carcinoma.
24823443 2014 HAUSP, a novel deubiquitinase for Rb - MDM2 the critical regulator.
24810223 2014 Genetic testing in Tunisian families with heritable retinoblastoma using a low cost approach permits accurate risk prediction in relatives and reveals incomplete penetrance in adults.
24809452 2014 Protein tyrosine phosphatases PTP-1B, SHP-2, and PTEN facilitate Rb/E2F-associated apoptotic signaling.
24798001 2014 Genomic portrait of resectable hepatocellular carcinomas: implications of RB1 and FGF19 aberrations for patient stratification.
24792491 2014 FRK suppresses the proliferation of human glioma cells by inhibiting cyclin D1 nuclear accumulation.
24791139 2014 Screening of RB1 gene mutations in Chinese patients with retinoblastoma and preliminary exploration of genotype-phenotype correlations.
24771265 2014 EZH2-specific microRNA-98 inhibits human ovarian cancer stem cell proliferation via regulating the pRb-E2F pathway.
24747969 2015 MUC4 regulates cellular senescence in head and neck squamous cell carcinoma through p16/Rb pathway.
24727455 2014 Identification of a genetic interaction between the tumor suppressor EAF2 and the retinoblastoma protein (Rb) signaling pathway in C. elegans and prostate cancer cells.
24703840 2014 Crosstalk between the Rb pathway and AKT signaling forms a quiescence-senescence switch.
24688104 2014 RB1 mutation spectrum in a comprehensive nationwide cohort of retinoblastoma patients.
24613344 2014 Suppression of genome instability in pRB-deficient cells by enhancement of chromosome cohesion.
24509483 2014 RB1 gene inactivation by chromothripsis in human retinoblastoma.
24485087 2014 Downregulation of Smurf2, a tumor-suppressive ubiquitin ligase, in triple-negative breast cancers: involvement of the RB-microRNA axis.
24433316 2014 De novo 13q13.3-21.31 deletion involving RB1 gene in a patient with hemangioendothelioma of the liver.
24406863 2014 Retinoblastoma gene mutations detected by whole exome sequencing of Merkel cell carcinoma.
24371076 2014 High-affinity Rb binding, p53 inhibition, subcellular localization, and transformation by wild-type or tumor-derived shortened Merkel cell polyomavirus large T antigens.
24350565 2014 Interaction between RB protein and NuMA is required for proper alignment of spindle microtubules.
24347427 2014 Mass-array screening of frequent mutations in cancers reveals RB1 alterations in aggressive adrenocortical carcinomas.
24336157 2014 Retinoblastoma pathway deregulatory mechanisms determine clinical outcome in high-grade serous ovarian carcinoma.
24335704 2014 Human herpesvirus 6 (HHV-6) alters E2F1/Rb pathways and utilizes the E2F1 transcription factor to express viral genes.
24334458 2014 Pancreatic cancer-associated retinoblastoma 1 dysfunction enables TGF-? to promote proliferation.
24324613 2013 Rb suppresses collective invasion, circulation and metastasis of breast cancer cells in CD44-dependent manner.
24323898 2014 Rb loss is characteristic of prostatic small cell neuroendocrine carcinoma.
24323028 2014 Integrative and comparative genomic analysis of lung squamous cell carcinomas in East Asian patients.
24302570 2013 Cytoplasmic translocation of the retinoblastoma protein disrupts sarcomeric organization.
24292676 2014 Conditional deletion of p53 and Rb in the renin-expressing compartment of the pancreas leads to a highly penetrant metastatic pancreatic neuroendocrine carcinoma.
24281253 2014 Silencing of RB1 and RB2/P130 during adipogenesis of bone marrow stromal cells results in dysregulated differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269417 2014 [Trilateral retinoblastoma. Correlation between the genetic anomalies of the RB1 gene and the presence of pineal gland cysts].
24254306 2014 Promoter hypermethylation of p14 (ARF) , RB, and INK4 gene family in hepatocellular carcinoma with hepatitis B virus infection.
24240190 2014 Arterial territory-specific phosphorylated retinoblastoma protein species and CDK2 promote differences in the vascular smooth muscle cell response to mitogens.
24231354 2013 Immune response to RB1-regulated senescence limits radiation-induced osteosarcoma formation.
24225018 2014 Spectrum of RB1 mutations identified in 403 retinoblastoma patients.
24189068 2013 Protein arginine methyltransferase 5 (PRMT5) inhibition induces lymphoma cell death through reactivation of the retinoblastoma tumor suppressor pathway and polycomb repressor complex 2 (PRC2) silencing.
24170547 2014 Direct inhibition of retinoblastoma phosphorylation by nimbolide causes cell-cycle arrest and suppresses glioblastoma growth.
24135281 2013 The role of Cdk5 in neuroendocrine thyroid cancer.
24121271 2014 The retinoblastoma tumor suppressor pathway modulates the invasiveness of ErbB2-positive breast cancer.
24103329 2014 Multiple mechanisms for E2F binding inhibition by phosphorylation of the retinoblastoma protein C-terminal domain.
24078560 2013 [Characteristics of RB1 gene mutations in Chinese patients with retinoblastoma].
24062075 2013 Expression of cell cycle regulatory factors hus1, gadd45a, rb1, cdkn2a and mre11a correlates with expression of clock gene per2 in human colorectal carcinoma tissue.
23981928 2013 Rapid detection of RB1 recurrent mutations in retinoblastoma by ARMS-PCR.
23981575 2014 MiR-215 modulates gastric cancer cell proliferation by targeting RB1.
23969248 2013 Rb protein is essential to the senescence-associated heterochromatic foci formation induced by HMGA2 in primary WI38 cells.
23967231 2013 Genomic deregulation of the E2F/Rb pathway leads to activation of the oncogene EZH2 in small cell lung cancer.
23967107 2013 Immunohistochemical analysis of retinoblastoma and ?-catenin as an assistant tool in the differential diagnosis between Crohn's disease and ulcerative colitis.
23949216 2013 Retinoblastoma protein regulates the crosstalk between autophagy and apoptosis, and favors glioblastoma resistance to etoposide.
23936312 2013 WT1 promotes cell proliferation in non-small cell lung cancer cell lines through up-regulating cyclin D1 and p-pRb in vitro and in vivo.
23932364 2013 High expression of SNIP1 correlates with poor prognosis in non-small cell lung cancer and SNIP1 interferes with the recruitment of HDAC1 to RB in vitro.
23916291 2013 A subset of malignant phyllodes tumors harbors alterations in the Rb/p16 pathway.
23900873 2013 Assessment of inverse correlation of p16 and pRb expression in carcinoma ex pleomorphic adenoma.
23900870 2013 Allelic loss of selected tumor suppressor genes in acute lymphoblastic leukemia in children.
23892435 2013 CASZ1 inhibits cell cycle progression in neuroblastoma by restoring pRb activity.
23887295 2014 P16 but not retinoblastoma expression is related to clinical outcome in no-special-type triple-negative breast carcinomas.
23859194 2013 Mitogen-activated protein kinase p38 and retinoblastoma protein signalling is required for DNA damage-mediated formation of senescence-associated heterochromatic foci in tumour cells.
23845465 2013 The metastatic behavior of osteosarcoma by gene expression and cytogenetic analyses.
23832541 2013 Cell cycle suppressor proteins are not related to HPV status or clinical outcome in patients with vulvar carcinoma.
23803020 2013 Cyclin D1, retinoblastoma and p16 protein expression in carcinoma of the gallbladder.
23792446 2014 Whole chromosome instability resulting from the synergistic effects of pRB and p53 inactivation.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23715307 Identification of three new mutations in the RB1 gene in patients with sporadic retinoblastoma in Colombia.
23707559 2013 Suppression of tumorigenicity by microRNA-138 through inhibition of EZH2-CDK4/6-pRb-E2F1 signal loop in glioblastoma multiforme.
23670186 2013 The Rb1 gene inhibits the viability of retinoblastoma cells by regulating homologous recombination.
23618872 2013 The retinoblastoma protein induces apoptosis directly at the mitochondria.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23595191 2013 Heritable retinoblastoma and accelerated aortic valve disease.
23532519 2013 Screening of RB1 alterations in Brazilian patients with retinoblastoma and relatives with retinoma: phenotypic and genotypic associations.
23498719 2013 Characterisation of retinoblastomas without RB1 mutations: genomic, gene expression, and clinical studies.
23449391 2013 p53 promotes VEGF expression and angiogenesis in the absence of an intact p21-Rb pathway.
23441118 2013 Screening for large rearrangements of the RB1 gene in Iranian patients with retinoblastoma using multiplex ligation-dependent probe amplification.
23429261 2013 pRb/E2F-1-mediated caspase-dependent induction of Noxa amplifies the apoptotic effects of the Bcl-2/Bcl-xL inhibitor ABT-737.
23427156 2013 Inactivation of retinoblastoma protein does not overcome the requirement for human cytomegalovirus UL97 in lamina disruption and nuclear egress.
23408605 2013 Ubiquitin-independent proteasomal degradation of tumor suppressors by human cytomegalovirus pp71 requires the 19S regulatory particle.
23383595 Invasive and prognostic significance of pRB in esophageal squamous cell carcinoma: a meta-analysis.
23370776 2013 Silencing of RB1 but not of RB2/P130 induces cellular senescence and impairs the differentiation potential of human mesenchymal stem cells.
23359405 2013 RB1 in cancer: different mechanisms of RB1 inactivation and alterations of pRb pathway in tumorigenesis.
23339186 2013 Nuclear expression of ?-catenin promotes RB stability and resistance to TNF-induced apoptosis in colon cancer cells.
23315497 2013 Decreased RB1 mRNA, protein, and activity reflect obesity-induced altered adipogenic capacity in human adipose tissue.
23308053 2012 The RB tumor suppressor positively regulates transcription of the anti-angiogenic protein NOL7.
23301675 2013 Spectrum of RB1 mutations in argentine patients: 20-years experience in the molecular diagnosis of retinoblastoma.
23289805 2013 Clinical findings and molecular diagnosis of retinoblastoma in older children.
23232572 2013 Molecular basis of urinary bladder cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178825 2013 miR-106a overexpression and pRB downregulation in sporadic colorectal cancer.
23157310 2013 Molecular dynamics simulations of retinoblastoma protein.
23108995 2013 MiR-26a regulates cell cycle and anoikis of human esophageal adenocarcinoma cells through Rb1-E2F1 signaling pathway.
23059827 2012 The retinoblastoma protein (Rb) as an anti-apoptotic factor: expression of Rb is required for the anti-apoptotic function of BAG-1 protein in colorectal tumour cells.
23041127 2013 Regulation of interlocking gene regulatory network subcircuits by a small molecule inhibitor of retinoblastoma protein (RB) phosphorylation: cancer cell expression of HLA-DR.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22998184 2012 The retinoblastoma protein: functions beyond the G1-S regulator.
22955272 2012 The retinoblastoma protein selectively represses E2F1 targets via a TAAC DNA element during cellular senescence.
22895174 2012 Dephosphorylation of threonine-821 of the retinoblastoma tumor suppressor protein (Rb) is required for apoptosis induced by UV and Cdk inhibition.
22874878 2013 Minor clone provides a reservoir for relapse in multiple myeloma.
22810586 2012 Interpreting cancer genomes using systematic host network perturbations by tumour virus proteins.
22802529 2012 The atypical E2F family member E2F7 couples the p53 and RB pathways during cellular senescence.
22790852 2012 Loss of retinoblastoma protein expression in spindle cell/pleomorphic lipomas and cytogenetically related tumors: an immunohistochemical study with diagnostic implications.
22787429 2012 RB1 methylation by SMYD2 enhances cell cycle progression through an increase of RB1 phosphorylation.
22744425 2012 Rb1/105 gene alterations and head and neck carcinogenesis.
22730229 2012 Parental diet and risk of retinoblastoma resulting from new germline RB1 mutation.
22706203 2012 The retinoblastoma gene undergoes rearrangements in BRCA1-deficient basal-like breast cancer.
22701041 2012 Retinoblastoma protein induction by HIV viremia or CCR5 in monocytes exposed to HIV-1 mediates protection from activation-induced apoptosis: ex vivo and in vitro study.
22698402 2012 Telomere-driven tetraploidization occurs in human cells undergoing crisis and promotes transformation of mouse cells.
22696061 2012 Regulation of epithelial differentiation and proliferation by the stroma: a role for the retinoblastoma protein.
22692183 2012 Contribution of retinoblastoma LOH and the p53 Arg/Pro polymorphism to cervical cancer.
22644489 2012 SHP-2 and PTP-pest induction during Rb-E2F associated apoptosis.
22643222 2012 Inactivation of Rb in stromal fibroblasts promotes epithelial cell invasion.
22586056 2012 Solitary fibrous tumor: is there a molecular relationship with cellular angiofibroma, spindle cell lipoma, and mammary-type myofibroblastoma?
22576742 2012 Retinoblastoma and p53 protein expression in pre-malignant oral lesions and oral squamous cell carcinoma.
22569856 2012 Structures of inactive retinoblastoma protein reveal multiple mechanisms for cell cycle control.
22493456 2012 Tumors with nonfunctional retinoblastoma protein are killed by reduced ?-tubulin levels.
22448711 2012 Twists in views on RB functions in cellular signaling, metabolism and stem cells.
22366686 2012 Senescence is an endogenous trigger for microRNA-directed transcriptional gene silencing in human cells.
22333593 2012 The specific role of pRb in p16 (INK4A) -mediated arrest of normal and malignant human breast cells.
22322860 2012 Retinoblastoma tumor-suppressor protein phosphorylation and inactivation depend on direct interaction with Pin1.
22310660 2012 Rb/E2F1 regulates the innate immune receptor Toll-like receptor 3 in epithelial cells.
22299668 2013 PP1 and PP2A phosphatases--cooperating partners in modulating retinoblastoma protein activation.
22265791 2012 [Molecular study of retinoblastoma in the Algerian population. Screening of Rb gene in constitutional and tumoral level].
22262832 2012 Induction of ZEB proteins by inactivation of RB protein is key determinant of mesenchymal phenotype of breast cancer.
22219649 2011 Mutational analysis of the RB1 gene in Moroccan patients with retinoblastoma.
22205104 2012 RB1 mutations and second primary malignancies after hereditary retinoblastoma.
22203219 2012 Mutation risk associated with paternal and maternal age in a cohort of retinoblastoma survivors.
22184068 2012 DNA damage signals through differentially modified E2F1 molecules to induce apoptosis.
22182413 2012 Liver tumor formation by a mutant retinoblastoma protein in the transgenic mice is caused by an upregulation of c-Myc target genes.
22157815 2012 The SNF2-like helicase HELLS mediates E2F3-dependent transcription and cellular transformation.
22157621 2012 Clinical stratification of glioblastoma based on alterations in retinoblastoma tumor suppressor protein (RB1) and association with the proneural subtype.
22112645 2012 IVF and retinoblastoma revisited.
22084214 2011 Outcomes of integrating genetics in management of patients with retinoblastoma.
21956461 2011 Human beta-defensin-2 controls cell cycle in malignant epithelial cells: in vitro study.
21952639 2011 NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21880723 2011 Retinoblastoma protein modulates the inverse relationship between cellular proliferation and elastogenesis.
21875955 2011 Notch signaling inhibits hepatocellular carcinoma following inactivation of the RB pathway.
21855804 2011 RB restricts DNA damage-initiated tumorigenesis through an LXCXE-dependent mechanism of transcriptional control.
21850486 2011 The natural diterpene ent-16?-17?-dihydroxykaurane down-regulates Bcl-2 by disruption of the Ap-2?/Rb transcription activating complex and induces E2F1 up-regulation in MCF-7 cells.
21809081 2012 Novel anti-apoptotic effect of the retinoblastoma protein: implications for polyamine analogue toxicity.
21763628 2011 RB1 gene mutations in Iranian patients with retinoblastoma: report of four novel mutations.
21752283 2011 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21740549 2011 An RNA interference screen for identifying downstream effectors of the p53 and pRB tumour suppressor pathways involved in senescence.
21725359 2012 Concurrent loss of the PTEN and RB1 tumor suppressors attenuates RAF dependence in melanomas harboring (V600E)BRAF.
21674866 Linkage analysis and detection of somatic, postzygous RB1 mutations in Serbian retinoblastoma patients.
21665145 2011 Mad2 is a critical mediator of the chromosome instability observed upon Rb and p53 pathway inhibition.
21663659 2011 Gain of DNA methylation is enhanced in the absence of CTCF at the human retinoblastoma gene promoter.
21654082 2011 Splicing aberrations caused by constitutional RB1 gene mutations in retinoblastoma.
21615945 2011 Low penetrance of retinoblastoma for p.V654L mutation of the RB1 gene.
21602887 2011 PAX8 promotes tumor cell growth by transcriptionally regulating E2F1 and stabilizing RB protein.
21593597 2011 CpG island hypermethylation of BRCA1 and loss of pRb as co-occurring events in basal/triple-negative breast cancer.
21567202 2012 Association analysis of p16 (CDKN2A) and RB1 polymorphisms with susceptibility to cervical cancer in Indian population.
21558273 2011 CCAAT/enhancer-binding protein beta inhibits proliferation in monocytic cells by affecting the retinoblastoma protein/E2F/cyclin E pathway but is not directly required for macrophage morphology.
21518927 2011 The lymphoma-associated NPM-ALK oncogene elicits a p16INK4a/pRb-dependent tumor-suppressive pathway.
21498571 2011 A kinase shRNA screen links LATS2 and the pRB tumor suppressor.
21493295 2011 Loss of heterozygosity of tumor suppressor genes (p16, Rb, E-cadherin, p53) in hypopharynx squamous cell carcinoma.
21491492 2011 Crystal structure of the unliganded retinoblastoma protein pocket domain.
21478909 2011 ARF1 controls proliferation of breast cancer cells by regulating the retinoblastoma protein.
21470325 2011 Alterations in the RB1 pathway in low-grade diffuse gliomas lacking common genetic alterations.
21447152 2011 Expression ratio of CCND1 to CDKN2A mRNA predicts RB1 status of cultured cancer cell lines and clinical tumor samples.
21440621 2011 Rb and nucleolin antagonize in controlling human CD34 gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21387305 2012 Analysis of retinoblastoma age incidence data using a fully stochastic cancer model.
21329664 2011 miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor.
21325879 2011 Direct and indirect effects of the pRb tumor suppressor on autophagy.
21278246 2011 Expression of p16 and retinoblastoma determines response to CDK4/6 inhibition in ovarian cancer.
21269460 2011 Initial characterization of the human central proteome.
21253829 2011 Alterations of the retinoblastoma gene in metastatic breast cancer.
21241471 2011 Retinoblastoma-independent antiproliferative activity of novel intracellular antibodies against the E7 oncoprotein in HPV 16-positive cells.
21203526 2010 RB1CC1 together with RB1 and p53 predicts long-term survival in Japanese breast cancer patients.
21148318 2011 Cyclin-dependent kinase-mediated phosphorylation of RBP1 and pRb promotes their dissociation to mediate release of the SAP30·mSin3·HDAC transcriptional repressor complex.
21139044 2010 Rb-Raf-1 interaction disruptor RRD-251 induces apoptosis in metastatic melanoma cells and synergizes with dacarbazine.
21119616 2011 Interplay between lysine methylation and Cdk phosphorylation in growth control by the retinoblastoma protein.
21099295 The CDK4-pRB-E2F1 pathway : A new modulator of insulin secretion.
21099110 2010 The retinoblastoma tumor suppressor controls androgen signaling and human prostate cancer progression.
21085491 2010 Interaction of the retinoblastoma protein with Orc1 and its recruitment to human origins of DNA replication.
21055153 2010 [Methylation and expression of gene p16INK4a and RB in breast carcinoma].
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21042734 2010 Rb family proteins in gastric cancer (review).
20971808 2010 CEBPD reverses RB/E2F1-mediated gene repression and participates in HMDB-induced apoptosis of cancer cells.
20948989 2010 miR-449a causes Rb-dependent cell cycle arrest and senescence in prostate cancer cells.
20948316 2010 Expression of the kinetochore protein Hec1 during the cell cycle in normal and cancer cells and its regulation by the pRb pathway.
20948315 2010 RB-pathway disruption in breast cancer: differential association with disease subtypes, disease-specific prognosis and therapeutic response.
20940255 2010 Acetylation of Rb by PCAF is required for nuclear localization and keratinocyte differentiation.
20924203 2011 Early cyst growth is associated with the increased nuclear expression of cyclin D1/Rb protein in an autosomal-recessive polycystic kidney disease rat model.
20890425 2010 Expression of pRb, p53, p16 and cyclin D1 and their clinical implications in urothelial carcinoma.
20871633 2011 p38 phosphorylates Rb on Ser567 by a novel, cell cycle-independent mechanism that triggers Rb-Hdm2 interaction and apoptosis.
20870719 2010 Methylation of the retinoblastoma tumor suppressor by SMYD2.
20864684 2010 Local mesenchymal stem/progenitor cells are a preferential target for initiation of adult soft tissue sarcomas associated with p53 and Rb deficiency.
20713352 2010 RB·E2F1 complex mediates DNA damage responses through transcriptional regulation of ZBRK1.
20705054 2010 SM22?-induced activation of p16INK4a/retinoblastoma pathway promotes cellular senescence caused by a subclinical dose of ?-radiation and doxorubicin in HepG2 cells.
20694007 2010 An overlapping kinase and phosphatase docking site regulates activity of the retinoblastoma protein.
20680693 2011 Prognostic significance of the alterations of the G1-S checkpoint in localized leiomyosarcoma of the peripheral soft tissue.
20680651 2011 The E2F-1 associated retinoblastoma-susceptibility gene product is modified by O-GlcNAc.
20668449 2010 NRMT is an alpha-N-methyltransferase that methylates RCC1 and retinoblastoma protein.
20628002 2010 Cryptotanshinone inhibits cancer cell proliferation by suppressing Mammalian target of rapamycin-mediated cyclin D1 expression and Rb phosphorylation.
20627193 2010 Using RB1 mutations to assess minimal residual disease in metastatic retinoblastoma.
20614030 2010 RB1CC1 activates RB1 pathway and inhibits proliferation and cologenic survival in human cancer.
20596833 2010 Exploring the structural and functional effect of pRB by significant nsSNP in the coding region of RB1 gene causing retinoblastoma.
20594292 2010 Identification and characterization of retinoblastoma gene mutations disturbing apoptosis in human breast cancers.
20565234 2010 RB pocket domain B mutation frequency in Malaysia.
20558744 2010 Gadd45b mediates Fas-induced apoptosis by enhancing the interaction between p38 and retinoblastoma tumor suppressor.
20551165 2010 Loss of pRB causes centromere dysfunction and chromosomal instability.
20534814 2010 The retinoblastoma protein modulates Tbx2 functional specificity.
20503270 2011 Use of cyclin D1 in conjunction with human papillomavirus status to predict outcome in oropharyngeal cancer.
20499310 2011 Immortalization of oral keratinocytes by functional inactivation of the p53 and pRb pathways.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20447117 2010 Role of genetic testing in retinoblastoma management at a tertiary referral centre.
20435627 2010 Genomic profiling of adult acute lymphoblastic leukemia by single nucleotide polymorphism oligonucleotide microarray and comparison to pediatric acute lymphoblastic leukemia.
20428774 2010 Spontaneous tumorigenicity of primary human oral keratinocytes with human papillomavirus negativity and impaired apoptosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20372802 2010 PNUTS knockdown potentiates the apoptotic effect of Roscovitine in breast and colon cancer cells.
20372796 2010 Carcinogenesis and cellular immortalization without persistent inactivation of p16/Rb pathway in lung cancer.
20362553 2010 Retinoblastoma protein co-purifies with proteasomal insulin-degrading enzyme: implications for cell proliferation control.
20336668 2010 Cross-talk between T-Ag presence and pRb family and p53/p73 signaling in mouse and human medulloblastoma.
20237430 2010 Absence of pRb facilitates E2F1-induced apoptosis in breast cancer cells.
20226085 2010 Overexpression of the JmjC histone demethylase KDM5B in human carcinogenesis: involvement in the proliferation of cancer cells through the E2F/RB pathway.
20226061 2010 LIMD1 is more frequently altered than RB1 in head and neck squamous cell carcinoma: clinical and prognostic implications.
20223825 2010 Phosphorylation-induced conformational changes in the retinoblastoma protein inhibit E2F transactivation domain binding.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20157766 2010 Notch signaling maintains proliferation and survival of the HL60 human promyelocytic leukemia cell line and promotes the phosphorylation of the Rb protein.
20140018 2010 Lysine methylation regulates the pRb tumour suppressor protein.
20100483 2010 Proliferative suppression by CDK4/6 inhibition: complex function of the retinoblastoma pathway in liver tissue and hepatoma cells.
20090211 2009 A comprehensive, sensitive and economical approach for the detection of mutations in the RB1 gene in retinoblastoma.
20088881 2010 Targeting mechanism of the retinoblastoma tumor suppressor by a prototypical viral oncoprotein. Structural modularity, intrinsic disorder and phosphorylation of human papillomavirus E7.
20082263 2009 Combined detection of p53, p16, Rb, and EGFR mutations in lung cancer by suspension microarray.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20059380 2010 A c.1363C>T (p.R455X) nonsense mutation of RB1 gene in a southern Chinese retinoblastoma pedigree.
20041224 2009 The human retinoblastoma gene is imprinted.
20037816 2009 Interaction among Rb/p16, Rb/E2F1 and HDAC1 proteins in gallbladder carcinoma.
20003272 2009 CENPA overexpression promotes genome instability in pRb-depleted human cells.
19950226 2010 Single nucleotide polymorphisms in miRNA binding sites and miRNA genes as breast/ovarian cancer risk modifiers in Jewish high-risk women.
19926638 2010 Oncofetal H19-derived miR-675 regulates tumor suppressor RB in human colorectal cancer.
19919588 2009 Expression of cyclin D1 and retinoblastoma protein in Paget's disease of the vulva and breast: an immunohistochemical study of 108 cases.
19903334 2009 The ATM and ATR inhibitors CGK733 and caffeine suppress cyclin D1 levels and inhibit cell proliferation.
19883508 2009 RNAi mediated acute depletion of retinoblastoma protein (pRb) promotes aneuploidy in human primary cells via micronuclei formation.
19880526 2009 Williams-Beuren syndrome-associated transcription factor TFII-I regulates osteogenic marker genes.
19863319 2009 Expression of p53, p16INK4A, pRb, p21WAF1/CIP1, p27KIP1, cyclin D1, Ki-67 and HPV DNA in sinonasal endophytic Schneiderian (inverted) papilloma.
19838216 2010 Knockdown of protein tyrosine phosphatase SHP-1 inhibits G1/S progression in prostate cancer cells through the regulation of components of the cell-cycle machinery.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19802012 2010 Modeling the effect of the RB tumor suppressor on disease progression: dependence on oncogene network and cellular context.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19723065 2009 Lactococcus lactis ssp. lactis inhibits the proliferation of SNU-1 human stomach cancer cells through induction of G0/G1 cell cycle arrest and apoptosis via p53 and p21 expression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19666944 2009 Reduced p16 and increased cyclin D1 and pRb expression are correlated with progression in cutaneous melanocytic tumors.
19648117 2009 Nutlin-3 affects expression and function of retinoblastoma protein: role of retinoblastoma protein in cellular response to nutlin-3.
19640284 2009 Constitutive RB1 mutation in a child conceived by in vitro fertilization: implications for genetic counseling.
19633425 2009 Sorafenib induces growth inhibition and apoptosis in human synovial sarcoma cells via inhibiting the RAF/MEK/ERK signaling pathway.
19631451 2009 p27-Associated G1 arrest induced by hinokitiol in human malignant melanoma cells is mediated via down-regulation of pRb, Skp2 ubiquitin ligase, and impairment of Cdk2 function.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19597473 2009 Counterbalance between RB inactivation and miR-17-92 overexpression in reactive oxygen species and DNA damage induction in lung cancers.
19594747 2009 Detection of gene copy number aberrations in mantle cell lymphoma by a single quantitative multiplex PCR assay: clinicopathological relevance and prognosis value.
19588502 2010 Inhibition of ovarian cancer cell proliferation by a cell cycle inhibitory peptide fused to a thermally responsive polypeptide carrier.
19556322 2009 High prevalence of retinoblastoma protein loss in triple-negative breast cancers and its association with a good prognosis in patients treated with adjuvant chemotherapy.
19477924 2009 Cdh1 regulates cell cycle through modulating the claspin/Chk1 and the Rb/E2F1 pathways.
19465901 2009 HPV infection and immunochemical detection of cell-cycle markers in verrucous carcinoma of the penis.
19458004 2009 Impaired replication of hepatitis C virus containing mutations in a conserved NS5B retinoblastoma protein-binding motif.
19430707 2009 Identification of aberrant cell cycle regulation in Epstein-Barr virus-associated nasopharyngeal carcinoma by cDNA microarray and gene set enrichment analysis.
19421149 2009 Inhibition of HPV-16 E7 oncogenic activity by HPV-16 E2.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19390654 2009 Germline mutations in retinoma patients: relevance to low-penetrance and low-expressivity molecular basis.
19389926 2009 Requirement of the Akt/beta-catenin pathway for uterine carcinosarcoma genesis, modulating E-cadherin expression through the transactivation of slug.
19383911 2009 Analysis of DNA copy number alterations in ovarian serous tumors identifies new molecular genetic changes in low-grade and high-grade carcinomas.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19280657 2009 Detection of mosaic RB1 mutations in families with retinoblastoma.
19279001 2009 Retinoblastoma/p107/p130 pocket proteins: protein dynamics and interactions with target gene promoters.
19258477 2009 Candidate gene analysis using imputed genotypes: cell cycle single-nucleotide polymorphisms and ovarian cancer risk.
19249677 2009 Proapoptotic function of the retinoblastoma tumor suppressor protein.
19225156 2009 Aurora B kinase regulates the postmitotic endoreduplication checkpoint via phosphorylation of the retinoblastoma protein at serine 780.
19223331 2009 HMGB1 and HMGB2 proteins up-regulate cellular expression of human topoisomerase IIalpha.
19212661 2009 Cellular growth inhibition by FK778 is linked to G1 arrest or S phase accumulation, dependent on the functional status of the retinoblastoma protein.
19160091 2009 Methylation patterns of Rb1 and Casp-8 promoters and their impact on their expression in bladder cancer.
19152247 2009 Expression of retinoblastoma and cyclin D1 in gastric carcinoma.
19149898 2009 The chromatin remodelling factor BRG1 is a novel binding partner of the tumor suppressor p16INK4a.
19144636 2009 AMP-activated protein kinase is involved in neural stem cell growth suppression and cell cycle arrest by 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranoside and glucose deprivation by down-regulating phospho-retinoblastoma protein and cyclin D.
19141402 2008 Loss of heterozygosity for Rb locus and pRb immunostaining in laryngeal cancer: a clinicopathologic, molecular and immunohistochemical study.
19140325 [Molecular-genetic analysis of clonal intratumoral heterogeneity on colorectal adenocarcinomas].
19137728 2008 [Epigenetic inactivation of the RB1 gene as a factor of genomic instability: a possible contribution to etiology of chromosomal mosaicism during human embryo development].
19130399 2009 Analysis of pRb, p16INK4A proteins and proliferating antigens: PCNA, Ki-67 and MCM5 expression in aggressive fibromatosis (desmoid tumor).
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19058005 2009 Does the expression of cyclin E, pRb, and p21 correlate with prognosis in gastric adenocarcinoma?
19017275 2009 Shigella flexneri type III secretion system effectors OspB and OspF target the nucleus to downregulate the host inflammatory response via interactions with retinoblastoma protein.
18976938 Retinoblastoma protein expression predicts response to bacillus Calmette-Guérin immunotherapy in patients with T1G3 bladder cancer.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18948382 2009 Hyperoxia-induced premature senescence requires p53 and pRb, but not mitochondrial matrix ROS.
18843795 2008 p16INK4a-induced senescence is disabled by melanoma-associated mutations.
18801742 2008 Proto-oncogene FBI-1 (Pokemon/ZBTB7A) represses transcription of the tumor suppressor Rb gene via binding competition with Sp1 and recruitment of co-repressors.
18794899 2008 E2F1 represses beta-catenin transcription and is antagonized by both pRB and CDK8.
18794045 2008 Alterations in the p16INK4a/cyclin D1/RB pathway in gastrointestinal tract endocrine tumors.
18782450 2008 The functional loss of the retinoblastoma tumour suppressor is a common event in basal-like and luminal B breast carcinomas.
18779498 2008 Familial retinoblastoma with unilateral and unifocal involvement in 2 families.
18768921 2008 The extreme COOH terminus of the retinoblastoma tumor suppressor protein pRb is required for phosphorylation on Thr-373 and activation of E2F.
18766991 2008 Trilateral retinoblastoma with pituitary-hypothalamic dysfunction.
18755268 2008 Myosin phosphatase interacts with and dephosphorylates the retinoblastoma protein in THP-1 leukemic cells: its inhibition is involved in the attenuation of daunorubicin-induced cell death by calyculin-A.
18702872 2008 The impact of trisomy 12, retinoblastoma gene and P53 in prognosis of B-cell chronic lymphocytic leukemia.
18697743 2008 Stress and IGF-I differentially control cell fate through mammalian target of rapamycin (mTOR) and retinoblastoma protein (pRB).
18694959 2008 Protein arginine methyltransferase 5 suppresses the transcription of the RB family of tumor suppressors in leukemia and lymphoma cells.
18691182 2008 Partial proteasome inhibition in human fibroblasts triggers accelerated M1 senescence or M2 crisis depending on p53 and Rb status.
18677770 2008 Identification of ARHGEF17, DENND2D, FGFR3, and RB1 mutations in melanoma by inhibition of nonsense-mediated mRNA decay.
18677112 2008 Low-penetrant RB allele in small-cell cancer shows geldanamycin instability and discordant expression with mutant ras.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632617 2008 SerpinB2 protection of retinoblastoma protein from calpain enhances tumor cell survival.
18624751 2009 Central chondrosarcoma progression is associated with pRb pathway alterations: CDK4 down-regulation and p16 overexpression inhibit cell growth in vitro.
18593909 2008 Rb depletion results in deregulation of E-cadherin and induction of cellular phenotypic changes that are characteristic of the epithelial-to-mesenchymal transition.
18546941 2007 [Alterations of cell cycle regulating proteins: Rb, p21 and p16 in laryngeal cancer].
18503160 2008 Spectrum of RB1 gene mutations and loss of heterozygosity in Mexican patients with retinoblastoma: identification of six novel mutations.
18483265 2008 A small molecule disruptor of Rb/Raf-1 interaction inhibits cell proliferation, angiogenesis, and growth of human tumor xenografts in nude mice.
18477220 2008 Immunohistochemistry of gliosarcoma with liposarcomatous differentiation.
18459177 2008 Retinoblastoma (Rb) tumor-suppressor pathway alterations in meningeal hemangiopericytomas: High E2F transcription factor 1 expression and loss of Rb expression: study by double immunofluorescence staining and laser-scanning confocal microscopy.
18458534 2008 Human breast cancer-associated fibroblasts (CAFs) show caveolin-1 downregulation and RB tumor suppressor functional inactivation: Implications for the response to hormonal therapy.
18431743 2008 Consortium analysis of 7 candidate SNPs for ovarian cancer.
18391203 2008 EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes.
18386058 2008 Alterations of RB1 gene in embryonal and alveolar rhabdomyosarcoma: special reference to utility of pRB immunoreactivity in differential diagnosis of rhabdomyosarcoma subtype.
18383208 2008 Chromosomal imbalances, loss of heterozygosity, and immunohistochemical expression of TP53, RB1, and PTEN in intraductal cancer, intraepithelial neoplasia, and invasive adenocarcinoma of the prostate.
18381962 2008 Loss of retinoblastoma tumor suppressor protein makes human breast cancer cells more sensitive to antimetabolite exposure.
18360108 2008 Reduced expression of PNUTS leads to activation of Rb-phosphatase and caspase-mediated apoptosis.
18348166 2008 Adenovirus E1A oncoprotein liberates c-Myc activity to promote cell proliferation through abating Bin1 expression via an Rb/E2F1-dependent mechanism.
18332869 2008 Retinoblastoma protein modulates gankyrin-MDM2 in regulation of p53 stability and chemosensitivity in cancer cells.
18321963 2008 Human cytomegalovirus UL97 kinase activity is required for the hyperphosphorylation of retinoblastoma protein and inhibits the formation of nuclear aggresomes.
18306932 2007 Alterations found in pl6/Rb/cyclin D1 pathway in the dysplastic and malignant cervical epithelium.
18305152 2008 TDP-43 regulates retinoblastoma protein phosphorylation through the repression of cyclin-dependent kinase 6 expression.
18296270 2008 Immunoexpression of P16INK4a, Rb and TP53 proteins in bronchiolar columnar cell dysplasia (BCCD) in lungs resected due to primary non-small cell lung cancer.
18294958 2008 TGFbeta-mediated formation of pRb-E2F complexes in human myeloid leukemia cells.
18281541 2008 Effects of common germ-line genetic variation in cell cycle genes on ovarian cancer survival.
18262051 2008 A novel subtelomeric translocation t(5;9) and a deletion of the RB1 gene in a patient with acute myeloid leukemia (AML-M0).
18236071 2008 Molecular characterisation of breast cancer patients at high and low recurrence risk.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18216119 2008 Cell cycle association of the retinoblastoma protein Rb and the histone demethylase LSD1 with the Epstein-Barr virus latency promoter Cp.
18211953 2008 Loss of RB1 induces non-proliferative retinoma: increasing genomic instability correlates with progression to retinoblastoma.
18196971 2008 A reciprocal relationship between Rb and Skp2: implications for restriction point control, signal transduction to the cell cycle and cancer.
18181215 2008 Patterns of missplicing caused by RB1 gene mutations in patients with retinoblastoma and association with phenotypic expression.
18073205 2008 Structure-function analysis of the THAP zinc finger of THAP1, a large C2CH DNA-binding module linked to Rb/E2F pathways.
18071317 2008 Aberrant nucleocytoplasmic localization of the retinoblastoma tumor suppressor protein in human cancer correlates with moderate/poor tumor differentiation.
18048012 2008 Expression of survivin and p16(INK4a)/Cdk6/pRB proteins and induction of apoptosis in response to radiation and cisplatin in meningioma cells.
18000883 2007 Pathogenic validation of unique germline intronic variants of RB1 in retinoblastoma patients using minigenes.
17996702 2007 Crystal structure of the retinoblastoma protein N domain provides insight into tumor suppression, ligand interaction, and holoprotein architecture.
17991896 2008 Protein phosphatase 2A subunit PR70 interacts with pRb and mediates its dephosphorylation.
17977825 2007 Human papillomavirus E7 requires the protease calpain to degrade the retinoblastoma protein.
17974914 2007 Structure of the retinoblastoma protein bound to adenovirus E1A reveals the molecular basis for viral oncoprotein inactivation of a tumor suppressor.
17963824 2008 pRB detection as a common event in human retinoblastomas: an immunohistochemical study.
17960112 2007 Ten novel RB1 gene mutations in patients with retinoblastoma.
17916908 2008 Survivin repression by p53, Rb and E2F2 in normal human melanocytes.
17913805 2007 Human herpesvirus 6A (HHV-6A) and HHV-6B alter E2F1/Rb pathways and E2F1 localization and cause cell cycle arrest in infected T cells.
17913706 2007 Myc down-regulation as a mechanism to activate the Rb pathway in STAT5A-induced senescence.
17900658 2007 Frequent epigenetic inactivation of Rb1 in addition to p15 and p16 in mantle cell and follicular lymphoma.
17880527 2007 Microsatellite abnormalities and somatic down-regulation of mismatch repair characterize nodular-trabecular muscle-invasive urothelial carcinoma of the bladder.
17877762 2007 High mobility group protein HMGA1 inhibits retinoblastoma protein-mediated cellular G0 arrest.
17804741 2007 Retinoblastoma deficiency increases chemosensitivity in lung cancer.
17716930 2007 Borealin is repressed in response to p53/Rb signaling.
17704056 2007 Regulation of E2F1 function by the nuclear corepressor KAP1.
17702869 2007 Forerunner genes contiguous to RB1 contribute to the development of in situ neoplasia.
17695524 Alterations of the p53, Rb and p27 tumor suppressor pathways in diffuse large B-cell lymphomas.
17686574 2007 Suppression of polyploidy by the BRCA2 protein.
17671693 2007 Downregulation of retinoblastoma protein is involved in the enhanced cytotoxicity of 4-hydroxytamoxifen plus mifepristone combination therapy versus antiestrogen monotherapy of human breast cancer.
17652530 2007 Aberrant methylation of multiple genes in gastric carcinomas.
17642181 [Analysis of the correlation between genetic and immunohistochemical markers (RB1, p16 and p53 gene regultors of a cell cycle) in sporadic mammary gland carcinoma].
17640669 2007 RB activity alters checkpoint response and chemosensitivity in lung cancer lines.
17620057 2007 Deacetylation of the retinoblastoma tumour suppressor protein by SIRT1.
17616676 2007 Retinoblastoma tumor suppressor status is a critical determinant of therapeutic response in prostate cancer cells.
17616526 2007 RbAp48 is a critical mediator controlling the transforming activity of human papillomavirus type 16 in cervical cancer.
17609271 2007 Human papillomavirus type 16 E7 oncoprotein associates with the cullin 2 ubiquitin ligase complex, which contributes to degradation of the retinoblastoma tumor suppressor.
17597480 2007 Latent membrane protein 1 encoded by Epstein-Barr virus induces telomerase activity via p16INK4A/Rb/E2F1 and JNK signaling pathways.
17576813 2007 BNIP3 is an RB/E2F target gene required for hypoxia-induced autophagy.
17557897 2007 Hypoxic stress underlies defects in erythroblast islands in the Rb-null mouse.
17549378 2007 Abrogation of the p16-retinoblastoma-cyclin D1 pathway in head and neck squamous cell carcinomas.
17540172 2007 L3MBTL1, a histone-methylation-dependent chromatin lock.
17523078 2007 Frequent intra-tumoural heterogeneity of promoter hypermethylation in malignant melanoma.
17511743 2007 A microtubule-facilitated nuclear import pathway for cancer regulatory proteins.
17495525 2007 The expression level of the tumor suppressor retinoblastoma protein (Rb) influences the antileukemic efficacy of erucylphospho-N,N,N-trimethylpropylammonium (ErPC3).
17490733 2007 Consequences of the loss of p53, RB1, and PTEN: relationship to gefitinib resistance in endometrial cancer.
17461478 2007 pRB expression in esophageal mucosa of individuals at high risk for squamous cell carcinoma of the esophagus.
17455244 2007 DNA damage response involves modulation of Ku70 and Rb functions by cyclin A1 in leukemia cells.
17428253 2007 Telomere dysfunction and inactivation of the p16(INK4a)/Rb pathway in pyothorax-associated lymphoma.
17413032 2007 G1 phase cell cycle arrest induced by SARS-CoV 3a protein via the cyclin D3/pRb pathway.
17390023 2007 Determination of the prognostic value of loss of heterozygosity at the retinoblastoma gene in osteosarcoma.
17380128 2007 Phosphorylation of pRB at Ser612 by Chk1/2 leads to a complex between pRB and E2F-1 after DNA damage.
17369843 2007 RB1 and TP53 pathways in radiation-induced sarcomas.
17369289 2007 Nox4 mediates TGF-beta1-induced retinoblastoma protein phosphorylation, proliferation, and hypertrophy in human airway smooth muscle cells.
17349581 2007 Kras(G12D) and Smad4/Dpc4 haploinsufficiency cooperate to induce mucinous cystic neoplasms and invasive adenocarcinoma of the pancreas.
17332242 2007 Inactivation of RB1 in mantle-cell lymphoma detected by nonsense-mediated mRNA decay pathway inhibition and microarray analysis.
17318405 2007 Altered structure and deregulated expression of the tumor suppressor gene retinoblastoma (RB1) in human brain tumors.
17299438 2007 A deep intronic mutation in the RB1 gene leads to intronic sequence exonisation.
17297463 2007 ARF promotes accumulation of retinoblastoma protein through inhibition of MDM2.
17286450 2007 RB1 germ-line deletions in Argentine retinoblastoma patients.
17274640 2007 A limited screen for protein interactions reveals new roles for protein phosphatase 1 in cell cycle control and apoptosis.
17216555 2007 Promoter hypermethylation profile of cell cycle regulator genes in pituitary adenomas.
17183714 2006 Separation of anti-proliferation and anti-apoptotic functions of retinoblastoma protein through targeted mutations of its A/B domain.
17182682 2007 Human papillomavirus E7 repression in cervical carcinoma cells initiates a transcriptional cascade driven by the retinoblastoma family, resulting in senescence.
17163992 2006 Rb induces a proliferative arrest and curtails Brn-2 expression in retinoblastoma cells.
17160137 2007 The retinoblastoma tumor suppressor modifies the therapeutic response of breast cancer.
17145812 2006 Detection of human papillomavirus and relevant tumor suppressors and oncoproteins in laryngeal tumors.
17131485 2006 Expression of altered retinoblastoma protein inversely correlates with tumor invasion in gastric carcinoma.
17094467 Alterations of the retinoblastoma and p16 pathway correlate with promoter methylation in malignant fibrous histiocytomas.
17047088 2006 Common variants in RB1 gene and risk of invasive ovarian cancer.
17045206 2006 p53 family members in myogenic differentiation and rhabdomyosarcoma development.
17043357 2006 Nucleocytoplasmic shuttling of the retinoblastoma tumor suppressor protein via Cdk phosphorylation-dependent nuclear export.
17031475 2007 Cellular thiol status-dependent inhibition of tumor cell growth via modulation of p27(kip1) translocation and retinoblastoma protein phosphorylation by 1'-acetoxychavicol acetate.
17028578 2006 Mitogenic signalling and the p16INK4a-Rb pathway cooperate to enforce irreversible cellular senescence.
17012228 2006 Expression of SUMO-2/3 induced senescence through p53- and pRB-mediated pathways.
16984923 2006 CDCA4 is an E2F transcription factor family-induced nuclear factor that regulates E2F-dependent transcriptional activation and cell proliferation.
16966377 2006 The HBP1 transcriptional repressor participates in RAS-induced premature senescence.
16964284 2007 Prohibitin, a protein downregulated by androgens, represses androgen receptor activity.
16948516 2006 Upper aerodigestive tract squamous dysplasia: correlation with p16, p53, pRb, and Ki-67 expression.
16936805 2006 Human lactoferrin controls the level of retinoblastoma protein and its activity.
16935576 2006 Role of the second-largest subunit of DNA polymerase alpha in the interaction between the catalytic subunit and hyperphosphorylated retinoblastoma protein in late S phase.
16916716 2006 The role of cell cycle regulatory proteins in the pathogenesis of melanoma.
16912184 2006 Functional interaction of the retinoblastoma and Ini1/Snf5 tumor suppressors in cell growth and pituitary tumorigenesis.
16880741 2006 Reverse mutational analysis reveals threonine-373 as a potentially sufficient phosphorylation site for inactivation of the retinoblastoma tumor suppressor protein (pRB).
16824683 2006 Membrane depolarization stimulates the proliferation of SH-SY5Y human neuroblastoma cells by increasing retinoblastoma protein (RB) phosphorylation through the activation of cyclin-dependent kinase 2 (Cdk2).
16816134 2006 Retinoblastoma tumor suppressor: where cancer meets the cell cycle.
16766265 2006 HMGA2 induces pituitary tumorigenesis by enhancing E2F1 activity.
16764854 2006 Dephosphorylation of Rb (Thr-821) in response to cell stress.
16763564 2006 Roles for APIS and the 20S proteasome in adenovirus E1A-dependent transcription.
16698799 2006 Cell cycle-controlled interaction of nucleolin with the retinoblastoma protein and cancerous cell transformation.
16685266 2006 Single-nucleotide polymorphisms in the RB1 gene and association with breast cancer in the British population.
16682285 2006 A molecular study of first and second RB1 mutational hits in retinoblastoma patients.
16682076 2006 Comparative analysis of hypermethylation of cell cycle control and DNA-mismatch repair genes in low-density and CD34+ bone marrow cells from patients with myelodysplastic syndrome.
16645588 2006 Re-expression of the retinoblastoma-binding protein 2-homolog 1 reveals tumor-suppressive functions in highly metastatic melanoma cells.
16619045 2006 Expression of hTERT immortalises normal human urothelial cells without inactivation of the p16/Rb pathway.
16616919 2006 The arginine methyltransferase PRMT2 binds RB and regulates E2F function.
16616093 2006 p16, retinoblastoma (pRb), and cyclin D1 protein expression in human endometriotic and adenomyotic lesions.
16614728 2006 Heterogeneous abnormalities of CCND1 and RB1 in primary cutaneous T-Cell lymphomas suggesting impaired cell cycle control in disease pathogenesis.
16595082 2006 [Molecular diagnosis of retinoblastoma: molecular epidemiology and genetic counseling].
16570290 2006 Overexpression of RB1 transcript is significantly correlated with 13q14 allelic imbalance in colorectal carcinomas.
16510145 2006 Effects of MdmX on Mdm2-mediated downregulation of pRB.
16464825 2006 Formation of the G-quadruplex and i-motif structures in retinoblastoma susceptibility genes (Rb).
16458891 2006 p205, a potential tumor suppressor, inhibits cell proliferation via multiple pathways of cell cycle regulation.
16388084 2005 Tumor deletion mapping of chromosomal region 13q14 in 43 growth hormone secreting pituitary adenomas.
16374512 2006 DNA-damage-responsive acetylation of pRb regulates binding to E2F-1.
16368535 2006 Alteration of Rb binding to HPV 18 E7 modified by transglutaminase 2 with different type of polyamines.
16360038 2005 Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release.
16354195 2005 Recurrent patterns of dual RB and p53 pathway inactivation in melanoma.
16352731 2005 Epstein-Barr virus latent antigen 3C can mediate the degradation of the retinoblastoma protein through an SCF cellular ubiquitin ligase.
16343421 2006 Mdm2-mediated pRB downregulation is involved in carcinogenesis in a p53-independent manner.
16337594 2005 MDM2 promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma protein.
16332962 2005 Down-regulation of the retinoblastoma tumor suppressor by the hepatitis C virus NS5B RNA-dependent RNA polymerase.
16315642 [Genomic retinoblastoma perspectives: implications of tumor supressor gene RB1].
16303160 2006 SARS coronavirus 7a protein blocks cell cycle progression at G0/G1 phase via the cyclin D3/pRb pathway.
16286473 2006 The retinoblastoma family proteins bind to and activate diacylglycerol kinase zeta.
16273238 2005 Alterations of p53, cyclin D1 and pRB expression in the carcinogenesis of esophageal squamous cell carcinoma.
16269091 2005 RB1 gene mutation up-date, a meta-analysis based on 932 reported mutations available in a searchable database.
16254459 Effect of promoter methylation of the p16 gene on phosphorylation of retinoblastoma gene product and growth of hepatocellular carcinoma cells.
16249186 2006 Structure of the human Papillomavirus E7 oncoprotein and its mechanism for inactivation of the retinoblastoma tumor suppressor.
16214886 2005 p600, a unique protein required for membrane morphogenesis and cell survival.
16212876 2005 p53-independent pRB degradation contributes to a drug-induced apoptosis in AGS cells.
16205627 2006 Phosphorylation site mutated RB exerts contrasting effects on apoptotic response to different stimuli.
16188218 2005 A transcriptional regulatory element screening system reveals a novel E2F1/pRb transcription regulation pathway.
16186801 2006 Rb inactivation leads to E2F1-mediated DNA double-strand break accumulation.
16127685 2005 Spectrum of gross deletions and insertions in the RB1 gene in patients with retinoblastoma and association with phenotypic expression.
16061792 2005 Association of the human papillomavirus type 16 E7 oncoprotein with the 600-kDa retinoblastoma protein-associated factor, p600.
16042572 2005 The role of the retinoblastoma protein (Rb) in the nuclear localization of BAG-1: implications for colorectal tumour cell survival.
16020958 2005 Alterations of rb pathway components are frequent events in patients with oral epithelial dysplasia and predict clinical outcome in patients with squamous cell carcinoma.
15949438 2005 Binding of pRB to the PHD protein RBP2 promotes cellular differentiation.
15939381 2005 Distinct patterns of expression of the RB gene family in mouse and human retina.
15927959 2005 Functional characterization of JMJD2A, a histone deacetylase- and retinoblastoma-binding protein.
15884040 2005 Sensitive multistep clinical molecular screening of 180 unrelated individuals with retinoblastoma detects 36 novel mutations in the RB1 gene.
15881662 2005 Altered structure and expression of RB1 gene and increased phosphorylation of pRb in human vestibular schwannomas.
15878620 2005 Aberrant expression of tumor suppressor genes and their association with chimeric oncogenes in pediatric acute lymphoblastic leukemia.
15838894 2005 Kinetic properties of nuclear transport conferred by the retinoblastoma (Rb) NLS.
15837424 2005 Selective ablation of retinoblastoma protein function by the RET finger protein.
15827088 2005 p130/p107/p105Rb-dependent transcriptional repression during DNA-damage-induced cell-cycle exit at G2.
15811853 2005 Smad7 abrogates transforming growth factor-beta1-mediated growth inhibition in COLO-357 cells through functional inactivation of the retinoblastoma protein.
15809752 2005 Differential response at the hGABP/E4TF1 site of retinoblastoma gene promoter in human testicular seminoma cells.
15809340 2005 Preferences for phosphorylation sites in the retinoblastoma protein of D-type cyclin-dependent kinases, Cdk4 and Cdk6, in vitro.
15803180 2005 Retinoblastoma-binding protein 2-homolog 1: a retinoblastoma-binding protein downregulated in malignant melanomas.
15776430 2005 Conservation of the RB1 gene in human and primates.
15767262 2005 Rb enhances p160/SRC coactivator-dependent activity of nuclear receptors and hormone responsiveness.
15763650 2005 Age at diagnosis of isolated unilateral retinoblastoma does not distinguish patients with and without a constitutional RB1 gene mutation but is influenced by a parent-of-origin effect.
15763542 2005 Retinoblastoma protein is required for efficient colorectal carcinoma cell apoptosis by histone deacetylase inhibitors in the absence of p21Waf.
15752352 2005 Dehydroepiandrosterone inhibits the proliferation of human umbilical vein endothelial cells by enhancing the expression of p53 and p21, restricting the phosphorylation of retinoblastoma protein, and is androgen- and estrogen-receptor independent.
15741232 2005 p25/Cdk5-mediated retinoblastoma phosphorylation is an early event in neuronal cell death.
15735762 2005 Induction of human metallothionein 1G promoter by VEGF and heavy metals: differential involvement of E2F and metal transcription factors.
15735701 2005 Caspase-9 can antagonize p53-induced apoptosis by generating a p76(Rb) truncated form of Rb.
15731778 2005 Phenotypic alterations in Rb pathway have more prognostic influence than p53 pathway proteins in oral carcinoma.
15716956 2005 Mitf cooperates with Rb1 and activates p21Cip1 expression to regulate cell cycle progression.
15709169 2005 Patterns of cyclin E, retinoblastoma protein, and p21Cip1/WAF1 immunostaining in the oncogenesis of papillary thyroid carcinoma.
15701640 2005 Retinoblastoma and the related pocket protein p107 act as coactivators of NeuroD1 to enhance gene transcription.
15684604 2005 Multiple functions of D-type cyclins can antagonize pRb-mediated suppression of proliferation.
15679863 2005 A novel form of pRb expressed during normal myelopoiesis and in tumour-associated macrophages.
15674338 2005 Retinoblastoma susceptibility gene product pRB activates hypoxia-inducible factor-1 (HIF-1).
15671551 2005 Prognostic implications of molecular and immunohistochemical profiles of the Rb and p53 cell cycle regulatory pathways in primary non-small cell lung carcinoma.
15655836 2005 Association of cyclin D1, p16 and retinoblastoma protein expressions with prognosis and metastasis of gallbladder carcinoma.
15647840 2005 Bone morphogenetic protein-2 induces hypophosphorylation of Rb protein and repression of E2F in androgen-treated LNCaP human prostate cancer cells.
15647383 2005 cAMP-mediated inhibition of DNA replication and S phase progression: involvement of Rb, p21Cip1, and PCNA.
15640164 2005 Loss of Rb-E2F repression results in caspase-8-mediated apoptosis through inactivation of focal adhesion kinase.
15583032 2004 Terminal osteoblast differentiation, mediated by runx2 and p27KIP1, is disrupted in osteosarcoma.
15580311 2005 The HTLV-I Tax oncoprotein targets the retinoblastoma protein for proteasomal degradation.
15577944 2005 Enhanced Mdm2 activity inhibits pRB function via ubiquitin-dependent degradation.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15564485 2004 Human papillomavirus type 16 E6 promotes retinoblastoma protein phosphorylation and cell cycle progression.
15547691 2004 Altered expression of cell cycle regulators Cyclin D1, p14, p16, CDK4 and Rb in nodular melanomas.
15542589 2004 LIM domains-containing protein 1 (LIMD1), a tumor suppressor encoded at chromosome 3p21.3, binds pRB and represses E2F-driven transcription.
15541338 2004 Regulation of Rb gene expression by an MBD2-interacting zinc finger protein MIZF during myogenic differentiation.
15538385 2004 Inhibition of oncogenic transformation by mammalian Lin-9, a pRB-associated protein.
15523694 2005 Genotype phenotype correlations in Israeli colorectal cancer patients.
15502804 2005 Overexpression and hyperphosphorylation of retinoblastoma protein in the progression of malignant melanoma.
15492985 2004 Aberrant expression of pRb and p16(INK4), alone or in combination, indicates poor outcome after resection in patients with colorectal carcinoma.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485920 2004 Disruption of the Rb--Raf-1 interaction inhibits tumor growth and angiogenesis.
15485814 2004 The central acidic domain of MDM2 is critical in inhibition of retinoblastoma-mediated suppression of E2F and cell growth.
15469821 2004 An Rb-Skp2-p27 pathway mediates acute cell cycle inhibition by Rb and is retained in a partial-penetrance Rb mutant.
15469703 2004 Detection of germline mutations in argentine retinoblastoma patients: low and full penetrance retinoblastoma caused by the same germline truncating mutation.
15467457 2004 A dynamic equilibrium between CDKs and PP2A modulates phosphorylation of pRB, p107 and p130.
15389598 2004 Down-regulation of p21WAF1 promotes apoptosis in senescent human fibroblasts: involvement of retinoblastoma protein phosphorylation and delay of cellular aging.
15389561 2005 In vitro and in vivo tumor growth inhibition by a p16-mimicking peptide in p16INK4A-defective, pRb-positive human melanoma cells.
15381253 2004 Activation of RB/E2F signaling pathway is required for the modulation of hepatitis C virus core protein-induced cell growth in liver and non-liver cells.
15367658 2004 PAM14, a novel MRG- and Rb-associated protein, is not required for development and T-cell function in mice.
15367600 2004 ORF73 of herpesvirus saimiri, a viral homolog of Kaposi's sarcoma-associated herpesvirus, modulates the two cellular tumor suppressor proteins p53 and pRb.
15308640 2004 Inactivation of p16INK4a, with retention of pRB and p53/p21cip1 function, in human MRC5 fibroblasts that overcome a telomere-independent crisis during immortalization.
15306814 2004 Rb inactivation promotes genomic instability by uncoupling cell cycle progression from mitotic control.
15264269 2004 Retinoblastoma: revisiting the model prototype of inherited cancer.
15210709 2004 Direct binding of apoptosis signal-regulating kinase 1 to retinoblastoma protein: novel links between apoptotic signaling and cell cycle machinery.
15199152 2004 Distinct mechanisms for repression of RNA polymerase III transcription by the retinoblastoma tumor suppressor protein.
15193257 2004 Cell-specific effects of RB or RB/p107 loss on retinal development implicate an intrinsically death-resistant cell-of-origin in retinoblastoma.
15169919 2004 Docking-dependent regulation of the Rb tumor suppressor protein by Cdk4.
15162822 2004 Outpatient clinic for genetic counseling and gene testing of retinoblastoma.
15161658 2004 Retinoblastoma protein is frequently absent or phosphorylated in anaplastic large-cell lymphoma.
15107404 2004 Liver tumors escape negative control of proliferation via PI3K/Akt-mediated block of C/EBP alpha growth inhibitory activity.
15105429 2004 Oct-1 maintains an intermediate, stable state of HLA-DRA promoter repression in Rb-defective cells: an Oct-1-containing repressosome that prevents NF-Y binding to the HLA-DRA promoter.
15084261 2004 Cyclin C/cdk3 promotes Rb-dependent G0 exit.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15048095 2004 Differential regulation of apoptotic genes by Rb in human versus mouse cells.
15044952 2004 Acetylation regulates the differentiation-specific functions of the retinoblastoma protein.
14966529 2004 pRb inactivation in mammary cells reveals common mechanisms for tumor initiation and progression in divergent epithelia.
14871261 2004 Expression of the proliferating cell nuclear antigen and protein products of tumour suppressor genes in the human foetal testis.
14737116 2004 Differences in stability of repressor complexes at promoters underlie distinct roles for Rb family members.
14732703 2004 Retinoblastoma susceptibility gene product (pRb) and p107 functionally separate the requirements for serum and anchorage in the cell cycle G1-phase.
14730602 2004 Retinoblastoma suppression of matrix metalloproteinase 1, but not interleukin-6, through a p38-dependent pathway in rheumatoid arthritis synovial fibroblasts.
14729647 2004 Retinoblastoma protein and CCAAT/enhancer-binding protein beta are required for 1,25-dihydroxyvitamin D3-induced monocytic differentiation of HL60 cells.
14722923 2004 Comprehensive screening for constitutional RB1 mutations by DHPLC and QMPSF.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14693709 2004 Induction of beta-cell proliferation and retinoblastoma protein phosphorylation in rat and human islets using adenovirus-mediated transfer of cyclin-dependent kinase-4 and cyclin D1.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14681231 2004 Tumor necrosis factor alpha inhibits cyclin A expression and retinoblastoma hyperphosphorylation triggered by insulin-like growth factor-I induction of new E2F-1 synthesis.
14676836 2004 Androgens repress Bcl-2 expression via activation of the retinoblastoma (RB) protein in prostate cancer cells.
14645241 2004 Interactions between activating signal cointegrator-2 and the tumor suppressor retinoblastoma in androgen receptor transactivation.
14631100 Ethnic variations of a retinoblastoma susceptibility gene (RB1) polymorphism in eight Asian populations.
14627988 2003 Cyclin E and Bcl-xL cooperatively induce cell cycle progression in c-Rel-/- B cells.
14625809 2003 Two new mutations and three novel polymorphisms in the RB1 gene in Ecuadorian patients.
14585976 2003 Retinoblastoma tumor suppressor: analyses of dynamic behavior in living cells reveal multiple modes of regulation.
14555653 2004 LEK1 is a potential inhibitor of pocket protein-mediated cellular processes.
14534726 Effect of retinoblastoma tumor suppressor gene expression on chemosensitivity of human osteosarcoma cell lines.
14533007 2003 RB1CC1 suppresses cell cycle progression through RB1 expression in human neoplastic cells.
14527418 2003 Active localization of the retinoblastoma protein in chromatin and its response to S phase DNA damage.
14519639 2003 Short postoperative survival for glioblastoma patients with a dysfunctional Rb1 pathway in combination with no wild-type PTEN.
14506250 2003 MRGX is a novel transcriptional regulator that exhibits activation or repression of the B-myb promoter in a cell type-dependent manner.
12963997 2003 Involvement of p21WAF1/CIP1, pRB, Bax and NF-kappaB in induction of growth arrest and apoptosis by resveratrol in human lung carcinoma A549 cells.
12947005 2004 C/EBPepsilon interacts with retinoblastoma and E2F1 during granulopoiesis.
12944478 2003 Inhibition of retinoblastoma protein degradation by interaction with the serpin plasminogen activator inhibitor 2 via a novel consensus motif.
12891711 2003 Tumor suppressor pRB functions as a co-repressor of the CCAAT displacement protein (CDP/cut) to regulate cell cycle controlled histone H4 transcription.
12860972 2003 Epstein-Barr virus LMP1 blocks p16INK4a-RB pathway by promoting nuclear export of E2F4/5.
12845674 2003 The retinoblastoma protein interacts with Bag-1 in human colonic adenoma and carcinoma derived cell lines.
12813456 2003 Interaction of the HPV E7 proteins with the pCAF acetyltransferase.
12809602 2003 Rb-mediated heterochromatin formation and silencing of E2F target genes during cellular senescence.
12761493 2003 Function of p73, not of p53, is inhibited by the physical interaction with RACK1 and its inhibitory effect is counteracted by pRB.
12757710 2003 Aging reduces proliferative capacities of liver by switching pathways of C/EBPalpha growth arrest.
12743606 2003 The adenovirus E1A oncoprotein recruits the cellular TRRAP/GCN5 histone acetyltransferase complex.
12695505 2003 Structural basis for the specificity of bipartite nuclear localization sequence binding by importin-alpha.
12682072 2003 Functional interactions between the estrogen receptor coactivator PELP1/MNAR and retinoblastoma protein.
12629508 2003 Identification of novel pRb binding sites using CpG microarrays suggests that E2F recruits pRb to specific genomic sites during S phase.
12621062 2003 Oxidative stress induces protein phosphatase 2A-dependent dephosphorylation of the pocket proteins pRb, p107, and p130.
12594215 2003 NF-kappa B-dependent induction of cyclin D1 by retinoblastoma protein (pRB) family proteins and tumor-derived pRB mutants.
12588990 2003 The N-terminal 24 amino acids of the p55 gamma regulatory subunit of phosphoinositide 3-kinase binds Rb and induces cell cycle arrest.
12569181 2003 First preimplantation genetic diagnosis of hereditary retinoblastoma using informative microsatellite markers.
12556968 2003 CpG island methylation status and mutation analysis of the RB1 gene essential promoter region and protein-binding pocket domain in nervous system tumours.
12532471 2003 Expression of p57kip2, Rb protein and PCNA and their relationships with clinicopathology in human pancreatic cancer.
12532331 2003 The E2F-1 transcription factor is negatively regulated by its interaction with the MDMX protein.
12528819 2003 Expression patterns of retinoblastoma protein in Parkinson disease.
12525503 2003 MAGE-A4 interacts with the liver oncoprotein gankyrin and suppresses its tumorigenic activity.
12508351 2003 Helicobacter pylori infection generated gastric cancer through p53-Rb tumor-suppressor system mutation and telomerase reactivation.
12507935 2002 Association of p16(INK4a) and pRb inactivation with immortalization of human cells.
12502741 2002 Structural basis for the recognition of the E2F transactivation domain by the retinoblastoma tumor suppressor.
12499093 2003 Relevance of p53, bcl-2 and Rb expression on resistance to cisplatin-based chemotherapy in advanced non-small cell lung cancer.
12479814 2002 The retinoblastoma-histone deacetylase 3 complex inhibits PPARgamma and adipocyte differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475961 2002 Lamin A/C binding protein LAP2alpha is required for nuclear anchorage of retinoblastoma protein.
12466551 2002 Skip interacts with the retinoblastoma tumor suppressor and inhibits its transcriptional repression activity.
12461781 2003 Identification of the novel role of pRB in eye cancer.
12459729 2002 The retinoblastoma tumour suppressor in development and cancer.
12450794 2002 Che-1 affects cell growth by interfering with the recruitment of HDAC1 by Rb.
12439743 2002 B-Myb overcomes a p107-mediated cell proliferation block by interacting with an N-terminal domain of p107.
12434308 2002 Protein Phosphatase 1 binds strongly to the retinoblastoma protein but not to p107 or p130 in vitro and in vivo.
12419581 2002 Identification of novel mutations in the RB1 gene in Mexican patients with retinoblastoma.
12401721 2002 Activation of cyclin D1-Cdk4 and Cdk4-directed phosphorylation of RB protein in diabetic mesangial hypertrophy.
12397079 2002 MRG15, a novel chromodomain protein, is present in two distinct multiprotein complexes involved in transcriptional activation.
12391839 [RB1 and CDKN2A functional defects resulting in retinoblastoma].
12391156 2002 The retinoblastoma protein binds the promoter of the survival gene bcl-2 and regulates its transcription in epithelial cells through transcription factor AP-2.
12377414 2002 Rearrangements involving the 13q chromosome arm committed to the progression of laryngeal squamous cell carcinoma.
12374284 2002 Retinoblastoma tumor suppressor and genome stability.
12362308 2002 [Low-penetrance retinoblastoma due to exons 24 and 25 deletions in the Rb1 gene].
12210730 2002 Interaction of the retinoblastoma gene product, RB, with cyclophilin A negatively affects cyclosporin-inhibited NFAT signaling.
12200151 2002 Pax-2 interacts with RB and reverses its repression on the promoter of Rig-1, a Robo member.
12197776 2002 Rb localization and phosphorylation kinetics correlate with the cellular phenotype of cultured breast adenocarcinoma cells.
12173465 [Spectrum and frequencies of RB1 gene structural defects in retinoblastoma].
12153616 2002 Expression of RB C pocket fragments in HSF induces delayed cell cycle progression and sensitizes to apoptosis upon cellular stresses.
12140374 2002 Differentiation of human melanoma cells through p38 MAP kinase is associated with decreased retinoblastoma protein phosphorylation and cell cycle arrest.
12096344 2002 The cyclin D1 high and cyclin E high subgroups of breast cancer: separate pathways in tumorogenesis based on pattern of genetic aberrations and inactivation of the pRb node.
12065415 2002 Prohibitin requires Brg-1 and Brm for the repression of E2F and cell growth.
12054658 2002 Oxidized low density lipoprotein induces the cyclin-dependent kinase inhibitor p21(waf1) and the tumor suppressor Rb.
12037672 2002 Physical interaction between pRb and cdk9/cyclinT2 complex.
12036888 2002 Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes.
12032846 2002 Human telomerase accelerates growth of lens epithelial cells through regulation of the genes mediating RB/E2F pathway.
11971966 2002 Physical interaction of human T-cell leukemia virus type 1 Tax with cyclin-dependent kinase 4 stimulates the phosphorylation of retinoblastoma protein.
11960384 2002 Activation of caspase-3 and cleavage of Rb are associated with p16-mediated apoptosis in human non-small cell lung cancer cells.
11956626 Allelic deletions of Rb and L-myc in urine sediments from patients with bladder tumors or carcinoma in situ.
11940667 2002 Tumor suppression by a severely truncated species of retinoblastoma protein.
11931757 2002 Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.
11909966 2002 Identification of mammalian Sds3 as an integral component of the Sin3/histone deacetylase corepressor complex.
11896613 2002 Constitutive expression of the Id-1 promoter in human metastatic breast cancer cells is linked with the loss of NF-1/Rb/HDAC-1 transcription repressor complex.
11847125 2002 The retinoblastoma gene product interacts with maintenance human DNA (cytosine-5) methyltransferase and modulates its activity.
11832063 2000 [Genetic polymorphisms of Rb and susceptibility of esophageal cancer].
11805327 2002 Characterization of protein kinase C beta isoform's action on retinoblastoma protein phosphorylation, vascular endothelial growth factor-induced endothelial cell proliferation, and retinal neovascularization.
11788883 2002 Suppression of tumorigenicity of rat liver tumor cells by human chromosome 13: evidence against the involvement of pRb and BRCA2.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11713253 2002 Human papillomavirus type 16 E7 binds to E2F1 and activates E2F1-driven transcription in a retinoblastoma protein-independent manner.
11596110 2001 Retinoblastoma protein complexes with C/EBP proteins and activates C/EBP-mediated transcription.
11583618 2001 Linking the Rb and polycomb pathways.
11571652 2001 The de-ubiquitinating enzyme Unp interacts with the retinoblastoma protein.
11571651 2001 Association of UNP, a ubiquitin-specific protease, with the pocket proteins pRb, p107 and p130.
11568901 2001 RB1 genetic testing as a clinical service: a follow-up study.
11566021 2001 Retinoblastoma protein interacts with ATF2 and JNK/p38 in stimulating the transforming growth factor-beta2 promoter.
11533237 2001 Transcriptional repression by the retinoblastoma protein through the recruitment of a histone methyltransferase.
11524739 2001 Identification of four novel RB1 germline mutations in Korean retinoblastoma patients.
11500496 2001 MRG15 activates the B-myb promoter through formation of a nuclear complex with the retinoblastoma protein and the novel protein PAM14.
11484059 2001 Rb targets histone H3 methylation and HP1 to promoters.
11433299 2001 Acetylation control of the retinoblastoma tumour-suppressor protein.
11420704 2001 Sequential two-step cleavage of the retinoblastoma protein by caspase-3/-7 during etoposide-induced apoptosis.
11268000 2001 Ebp1, an ErbB-3 binding protein, interacts with Rb and affects Rb transcriptional regulation.
11254678 2001 Cutting edge: differential signaling requirements for activation of assembled cyclin D3-cdk4 complexes in B-1 and B-2 lymphocyte subsets.
11226179 2001 Structural basis for the inactivation of retinoblastoma tumor suppressor by SV40 large T antigen.
11223246 2001 Identification and characterization of a novel human cDNA encoding a 21 kDa pRb-associated protein.
11162467 2001 Binding of phosphatase-1 delta to the retinoblastoma protein pRb involves domains that include substrate recognition residues and a pRB binding motif.
11113200 2001 MAT1-modulated CAK activity regulates cell cycle G(1) exit.
11094070 2000 The retinoblastoma tumor suppressor protein targets distinct general transcription factors to regulate RNA polymerase III gene expression.
11085541 2000 BRG1, a component of the SWI-SNF complex, is mutated in multiple human tumor cell lines.
11073990 2000 A novel Rb- and p300-binding protein inhibits transactivation by MyoD.
11073989 2000 Cells degrade a novel inhibitor of differentiation with E1A-like properties upon exiting the cell cycle.
11042686