Property Summary

NCBI Gene PubMed Count 4
PubMed Score 12.79
PubTator Score 6.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 3.1e-05

Gene RIF (2)

AA Sequence

MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVR      1 - 70
VQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGP     71 - 140
GLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA                              141 - 184
//

Text Mined References (6)

PMID Year Title