Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.81
PubTator Score 1.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 GO Function (1)

Gene RIF (2)

AA Sequence

MAPFGRNLLKTRHKNRSPTKDMDSEEKEIVVWVCQEEKLVCGLTKRTTSADVIQALLEEHEATFGEKRFL      1 - 70
LGKPSDYCIIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKADAFLPVPLWRTAEAKLVQNTEKL     71 - 140
WELSPANYMKTLPPDKQKRIVRKTFRKLAKIKQDTVSHDRDNMETLVHLIISQDHTIHQQVKRMKELDLE    141 - 210
IEKCEAKFHLDRVENDGENYVQDAYLMPSFSEVEQNLDLQYEENQTLEDLSESDGIEQLEERLKYYRILI    211 - 280
DKLSAEIEKEVKSVCIDINEDAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLL    281 - 350
QMKAKEYELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHS    351 - 420
QDSETTVGDVVLLST                                                           421 - 435
//

Text Mined References (7)

PMID Year Title