Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.37
PubTator Score 6.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Atopic dermatitis -1.100 7.1e-04
glioblastoma 1.700 4.7e-03
group 4 medulloblastoma 1.600 3.5e-05
interstitial cystitis -1.100 2.1e-02
intraductal papillary-mucinous adenoma (... -1.200 4.5e-02
intraductal papillary-mucinous carcinoma... -1.900 9.5e-03
lung adenocarcinoma -1.400 2.3e-18
lung cancer -1.100 2.7e-03
lung carcinoma -1.100 4.3e-17
malignant mesothelioma -2.800 3.7e-07
medulloblastoma, large-cell 1.500 7.4e-05
non-small cell lung cancer -1.326 7.7e-10
osteosarcoma 1.650 1.3e-02
ovarian cancer -3.200 5.8e-06
Pick disease 1.100 2.4e-03
ulcerative colitis 1.300 4.5e-03

Gene RIF (8)

AA Sequence

MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYA      1 - 70
SDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAKGLM     71 - 140
DIFGKGKETEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLE    141 - 210
QKIKRNDVEIEEEEFWENELQIEQENEKQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQRE    211 - 280
VQEAQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQ    281 - 350
QFIQQTGTKVTVLPAEPIEIEASHADIEREAPFQSGSLKRPGSSRQLPSNLRILQNPISSGFNPEGIYV     351 - 419
//

Text Mined References (21)

PMID Year Title