Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.41
PubTator Score 62.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.0e-08
pilocytic astrocytoma 3086 1.3e-05
group 4 medulloblastoma 1875 4.3e-04
breast carcinoma 1614 2.4e-03

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.300 2.4e-03
group 4 medulloblastoma -1.100 4.3e-04
pilocytic astrocytoma -1.100 1.3e-05
ovarian cancer -1.400 2.0e-08

Gene RIF (6)

PMID Text
26569555 truncated RASSF7 could act as an oncogene in a small subset of tumours where it is mutated in this way.
22695170 The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma.
21278800 RASSF7 acts in concert with N-Ras to constitute a stress-sensitive temporary mechanism of apoptotic regulation.
20629633 RASSF7 regulates the microtubule cytoskeleton and is required for spindle formation, Aurora B activation and chromosomal congression during mitosis.
19367319 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15098441 "rare" alleles of HRas1 minisatellite are associated with increased risk of papillary thyroid cancer formation in children and adolescents after Chernobyl accident

AA Sequence

MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ      1 - 70
ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG     71 - 140
PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL    141 - 210
DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL    211 - 280
EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA    281 - 350
ELLEVAAAPAPEWCPLAAQPQAL                                                   351 - 373
//

Text Mined References (15)

PMID Year Title
26569555 2016 Truncated RASSF7 promotes centrosomal defects and cell death.
25416956 2014 A proteome-scale map of the human interactome network.
22695170 2012 The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma.
21278800 2011 RASSF7 negatively regulates pro-apoptotic JNK signaling by inhibiting the activity of phosphorylated-MKK7.
20629633 2010 Human RASSF7 regulates the microtubule cytoskeleton and is required for spindle formation, Aurora B activation and chromosomal congression during mitosis.
19367319 2009 Human longevity and 11p15.5: a study in 1321 centenarians.
18272789 2008 RASSF7 is a member of a new family of RAS association domain-containing proteins and is required for completing mitosis.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15098441 [Study of HRas1 minisatellite frequencies in children with thyroid papillary cancer].
12812986 2003 DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1339391 1992 The HRAS1 gene cluster: two upstream regions recognizing transcripts and a third encoding a gene with a leucine zipper domain.