Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.51
PubTator Score 16.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.039 4.9e-03
periodontitis 1.200 7.4e-18
tuberculosis -1.600 2.4e-04
non-small cell lung carcinoma 1.300 1.5e-16
intraductal papillary-mucinous adenoma (... 2.500 3.8e-04
intraductal papillary-mucinous carcinoma... 1.900 9.7e-04
intraductal papillary-mucinous neoplasm ... 2.100 1.6e-02
interstitial cystitis -3.000 1.7e-03
Endometriosis -1.088 1.9e-02
breast carcinoma -1.400 4.1e-13
spina bifida -1.133 2.7e-02
Breast cancer -2.100 4.6e-08

Gene RIF (12)

PMID Text
26074700 RASSF6 expression is an independent biomarker of an unfavorable prognosis in patients with pancreatic ductal adenocarcinoma.
25482183 RASSF6 exhibits promoter hypermethylation in metastatic melanoma and inhibits invasion in melanoma cells.RASSF6 exhibits the highest frequency of inactivation in melanoma and in melanoma brain metastases.
25028967 downregulation of RASSF6 in highly metastatic nasopharyngeal carcinoma cells contributed to their treatment resistance
24626183 Mechanistic investigation shows that RASSF6 triggers p21(Cip1/Waf1) accumulation to induce G 1 cell cycle arrest and promote apoptosis upon exposure to pro-apoptotic agents, and both of these mechanisms appear to be mediated by activated JNK signaling.
24003224 RASSF6-induced apoptosis partially depends on p53. RASSF6 binds MDM2 and facilitates its ubiquitination. RASSF6 depletion blocks the increase of p53 in response to UV exposure and up-regulation of p53 target genes.
22695170 The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma.
21442347 Decreased expression of RASSF6 is associated with gastric cancer.
19797269 activation of MST2 causes apoptosis through the Hippo pathway, as well as through a RASSF6-mediated pathway
19570220 Sequencing revealed RASSF6 and RASSF10 were the only RASSF members with a high frequency of leukaemia-specific methylation.
18563170 Observational study of gene-disease association. (HuGE Navigator)
17404571 Demonstrates properties of a Ras effector and tumor suppressor but exhibits biological properties that are unique and distinct from those of other family members.
17367779 These findings indicate that RASSF6 is implicated in apoptosis in HeLa cells and that it triggers both caspase-dependent and caspase-independent pathways.

AA Sequence

MLWEETGAAPAPARASDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYEN      1 - 70
QKNLHILYGETEDGKLIVEGMLDIFWGVKRPIQLKIQDEKPFSSFTSMKSSDVFSSKGMTRWGEFDDLYR     71 - 140
ISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYRTMSEAALVRKRMKPLMMDRKERQKNR    141 - 210
ASINGHFYNHETSIFIPAFESETKVRVNSNMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKT    211 - 280
DIPLLQRLLQGPSEKNARIFLMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEK    281 - 350
AIILKCLQNKLVIKTETTV                                                       351 - 369
//

Text Mined References (23)

PMID Year Title
26074700 2015 Low RASSF6 expression in pancreatic ductal adenocarcinoma is associated with poor survival.
25482183 2014 RASSF6 exhibits promoter hypermethylation in metastatic melanoma and inhibits invasion in melanoma cells.
25028967 2014 Downregulation of Ras association domain family member 6 (RASSF6) underlies the treatment resistance of highly metastatic nasopharyngeal carcinoma cells.
24626183 2014 RASSF6 promotes p21(Cip1/Waf1)-dependent cell cycle arrest and apoptosis through activation of the JNK/SAPK pathway in clear cell renal cell carcinoma.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24003224 2013 The RASSF6 tumor suppressor protein regulates apoptosis and the cell cycle via MDM2 protein and p53 protein.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22695170 2012 The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma.
22577168 2012 Expression of RASSF6 in kidney and the implication of RASSF6 and the Hippo pathway in the sorbitol-induced apoptosis in renal proximal tubular epithelial cells.
22530128 2012 Combined RASSF1A and RASSF2A Promoter Methylation Analysis as Diagnostic Biomarker for Bladder Cancer.
22430796 2012 KIBRA gene methylation is associated with unfavorable biological prognostic parameters in chronic lymphocytic leukemia.
21442347 2011 Decreased expression of RASSF6 is a novel independent prognostic marker of a worse outcome in gastric cancer patients after curative surgery.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
19797269 2009 Hippo pathway-dependent and -independent roles of RASSF6.
19570220 2009 The novel RASSF6 and RASSF10 candidate tumour suppressor genes are frequently epigenetically inactivated in childhood leukaemias.
18563170 2008 Modulation of cystic fibrosis lung disease by variants in interleukin-8.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17404571 2007 RASSF6 is a novel member of the RASSF family of tumor suppressors.
17367779 2007 Ras-association domain family protein 6 induces apoptosis via both caspase-dependent and caspase-independent pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14605870 2004 Haplotype mapping of the bronchiolitis susceptibility locus near IL8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.