Property Summary

NCBI Gene PubMed Count 63
PubMed Score 69.43
PubTator Score 55.37

Knowledge Summary

Patent

No data available

TINX Plot

 GWAS Trait (1)

Gene RIF (39)

PMID Text
26986513 mCD40L-induced cell death mediated by NORE1A expression appeared to be independent of mCD40L-induced cell death mediated by sustained JNK activation since NORE1A inhibition did not affect JNK phosphorylation and vice versa
26677227 Ras induces the formation of a complex between NORE1A and the phosphatase PP1A, promoting the activation of the Rb tumor suppressor by dephosphorylation
25778922 NORE1A allows Ras to qualitatively modify p53 function to promote senescence.
25579665 the inactivation of RASSF5A through CpG island 1 methylation may play an important role in esophageal squamous cell carcinoma (ESCC) carcinogenesis, RASSF5A may be a functional tumor suppressor and may serve as a prognostic biomarker for ESCC.
25420558 Down-regulation of RASSF5A and RASSF5C expression is a tumor-specific phenomenon.
25217643 NORE1A has a role in Ras regulation of SCF(beta-TrCP) protein activity and specificity
25109282 RASSF5 expression is negatively correlated with distant metastasis of osteosarcoma, and RASSF5 may function as a tumor suppressor in OS cells through activation of the MST1/LATS1 pathway.
23972470 RASSF5 can act as an inhibitor or a potential positive regulator of Mst2, depending on whether it binds to Mst2 before or after activation-loop phosphorylation.
23538446 Ubiquitin ligase Itch is a unique negative regulator of RASSF5.
22750872 crystal of NORE1 diffracted to 2.7 A resolution and belonged to space group P6(1)22, with unit-cell parameters a = b = 73.041, c = 66.092 A, alpha = beta = 90, gamma = 120 degrees
22695170 The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma.
22173032 These findings indicate that the control of HIPK1 stability by Mdm2-NORE1 has a major effect on cell behaviour, and epigenetic inactivation of NORE1 enables adenocarcinoma formation in vivo through HIPK1 stabilization.
21669874 N-terminal myr-tagged SKAP1 for membrane binding facilitated constitutive RapL membrane and Rap1 binding and effectively substituted for PI3K and TCR ligation in the activation of LFA-1 in T cells.
20969767 epigenetic inactivation of NORE1 due to aberrant promoter hypermethylation is a frequent event in colorectal tumorigenesis and might be implicated in the malignant progression of colorectal tumors
20508983 Observational study of gene-disease association. (HuGE Navigator)
20434789 NORE1A has activity that suppresses the centrosome amplification induced by HU and that NORE1A mRNA down-regulation is one of the common gene abnormalities in NSCLCs, both of which imply a key preventive role of NORE1A against the carcinogenesis of NSCLC.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346707 findings define a T cell receptor "inside-out" pathway via N-SKAP1-C-RapL that regulates T cell adhesion, motility, and arrest times with dendritic cells in lymph nodes.
20339001 a novel regulatory network composed of the tumor suppressor NORE1A, the mitotic kinase Aurora A, the small GTPase Ras, and the microtubule cytoskeleton.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20064523 The present investigation provided evidence that Lck-mediated phosphorylation regulates the nucleocytoplasmic shuttling and cell growth control activities of RASSF5.
19435914 NORE1A activates p21(CIP1) via promoting p53 nuclear localization.
19118008 NORE1B suppresses replication and transformation of cells as effectively as RASSF1A and is a putative tumor suppressor gene. NORE1B interacts with RASSF1A and loss of one of these may lead to uncontrolled growth and transformation of hepatocytes.
19098985 Data show that degradation by calpains is a novel mechanism for downregulation of NORE1A and RASSF1A proteins and might be the mechanism allowing cancer cells to escape growth suppression.
18616639 findings showed that only 4% of the glioma tumors revealed a methylated promoter for NORE1A
18596699 Study describes the crystal structure of Ras in complex with the Ras binding domain (RBD) of NORE1A; the contact area of NORE1A is extended as compared with other Ras effectors & provides a rationale for an exceptionally long lifetime of the complex.
18452173 NORE1A promoter methylation is a rare event in neuroblastoma cells and primary tumors. Other mechanisms are likely to account for the frequent reduction of NORE1A mRNA expression. Also, antitumorigenic role of NORE1A in human neuroblastoma is evident.
18211824 nuclear export of NORE1A via nuclear export signal is involved in the NORE1A-mediated induction of apoptosis
17716979 interaction surfaces in RAPL-Rap1 and RAPL-Rap2 complexes are different and that a single residue in the switch I region of Rap proteins (residue 39) contributes considerably to the different kinetics of these protein-protein interactions.
17320110 Nuclear localization of RASSF5 is critical for its cell growth control activity.
16606445 The NORE1A gene was never found epigenetically methylated in hepatitic or non-hepatitic liver.
16520020 These findings suggest that endogenous Nore1B recruits active Ras to the APC-T cell interface and mediates the interaction between Ras and Carma1.
16516329 The candidate tumor suppressor gene NORE1B is epigenetically down-regulated in hepatocellular carcinoma.
16421102 association of NORE1A with cytoskeletal elements is essential for NORE1A-induced growth suppression and that the ERK pathway is a target for NORE1A growth-suppressive activities
16352687 Suppression of NORE1A, a known Ras effector, in PAX8-PPARgamma fusion-carrying follicular thyroid cancer.
15980887 results indicate that RASSF1A epigenetic changes are an early event in thyroid tumor pathogenesis and progression
15569673 Rap1 activation contributes to directional vascular endothelial cell migration accompanied by extension of microtubules on which RAPL localizes
15378027 the epigenetic alteration of NORE1A is confined to lung tumors with a wild-type K-ras: 88% (15 of 17) of the tumors with NORE1 hypermethylation did not harbor a K-ras mutation (P=0.008, Fisher's exact test)
12676952 Nore1 is a member of a family of Ras effector/tumor suppressors that includes RASSF1

AA Sequence

MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNL      1 - 70
EPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLC     71 - 140
GREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQE    141 - 210
IKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSF    211 - 280
YLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGP    281 - 350
DTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG      351 - 418
//

Text Mined References (68)

PMID Year Title
26986513 2016 NORE1A induction by membrane-bound CD40L (mCD40L) contributes to CD40L-induced cell death and G1 growth arrest in p21-mediated mechanism.
26677227 2016 Ras Regulates Rb via NORE1A.
25778922 2015 NORE1A is a Ras senescence effector that controls the apoptotic/senescent balance of p53 via HIPK2.
25579665 2015 RASSF5A, a candidate tumor suppressor, is epigenetically inactivated in esophageal squamous cell carcinoma.
25420558 2015 Decreased expression and aberrant methylation of RASSF5A correlates with malignant progression of gastric cardia adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25217643 2014 Ras regulates SCF(?-TrCP) protein activity and specificity via its effector protein NORE1A.
25109282 2014 RASSF5 inhibits growth and invasion and induces apoptosis in osteosarcoma cells through activation of MST1/LATS1 signaling.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23972470 2013 Structural basis for autoactivation of human Mst2 kinase and its regulation by RASSF5.
23538446 2013 The E3 ubiquitin ligase Itch regulates tumor suppressor protein RASSF5/NORE1 stability in an acetylation-dependent manner.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22750872 2012 Expression, purification, crystallization and preliminary X-ray analysis of the human NORE1 SARAH domain.
22695170 2012 The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma.
22173032 2012 Mdm2 associates with Ras effector NORE1 to induce the degradation of oncoprotein HIPK1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21669874 2011 SKAP1 protein PH domain determines RapL membrane localization and Rap1 protein complex formation for T cell receptor (TCR) activation of LFA-1.
21269460 2011 Initial characterization of the human central proteome.
20969767 2010 Epigenetic inactivation of the NORE1 gene correlates with malignant progression of colorectal tumors.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20562859 2010 Network organization of the human autophagy system.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20434789 2011 Suppression of hydroxyurea-induced centrosome amplification by NORE1A and down-regulation of NORE1A mRNA expression in non-small cell lung carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346707 2010 T cell receptor "inside-out" pathway via signaling module SKAP1-RapL regulates T cell motility and interactions in lymph nodes.
20339001 2010 Growth and tumor suppressor NORE1A is a regulatory node between Ras signaling and microtubule nucleation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20064523 2010 Functional interaction of the Ras effector RASSF5 with the tyrosine kinase Lck: critical role in nucleocytoplasmic transport and cell cycle regulation.
19435914 2009 NORE1A tumor suppressor candidate modulates p21CIP1 via p53.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19118008 2009 NORE1B is a putative tumor suppressor in hepatocarcinogenesis and may act via RASSF1A.
19098985 2008 The growth and tumor suppressors NORE1A and RASSF1A are targets for calpain-mediated proteolysis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18616639 2009 RASSF1A, BLU, NORE1A, PTEN and MGMT expression and promoter methylation in gliomas and glioma cell lines and evidence of deregulated expression of de novo DNMTs.
18596699 2008 Novel type of Ras effector interaction established between tumour suppressor NORE1A and Ras switch II.
18452173 2008 Assessment of NORE1A as a putative tumor suppressor in human neuroblastoma.
18211824 2008 Induction of apoptosis by NORE1A in a manner dependent on its nuclear export.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17716979 2007 Characterization of interactions of adapter protein RAPL/Nore1B with RAP GTPases and their role in T cell migration.
17320110 2007 Nuclear transport of Ras-associated tumor suppressor proteins: different transport receptor binding specificities for arginine-rich nuclear targeting signals.
16892067 2006 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion.
16757334 2006 RASSF family proteins and Ras transformation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16606445 2006 Quantitative evaluation of RASSF1A methylation in the non-lesional, regenerative and neoplastic liver.
16520020 2006 Nore1B regulates TCR signaling via Ras and Carma1.
16516329 2006 NORE1B, a candidate tumor suppressor, is epigenetically silenced in human hepatocellular carcinoma.
16421102 2006 The growth and tumor suppressor NORE1A is a cytoskeletal protein that suppresses growth by inhibition of the ERK pathway.
16352687 2006 The Ras effector NORE1A is suppressed in follicular thyroid carcinomas with a PAX8-PPARgamma fusion.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15980887 2005 RASSF1A and NORE1A methylation and BRAFV600E mutations in thyroid tumors.
15569673 2005 Local activation of Rap1 contributes to directional vascular endothelial cell migration accompanied by extension of microtubules on which RAPL, a Rap1-associating molecule, localizes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378027 2004 CpG island promoter hypermethylation of the Ras-effector gene NORE1A occurs in the context of a wild-type K-ras in lung cancer.
15109305 2004 Regulation of the MST1 kinase by autophosphorylation, by the growth inhibitory proteins, RASSF1 and NORE1, and by Ras.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667507 2003 The t(1;3) breakpoint-spanning genes LSAMP and NORE1 are involved in clear cell renal cell carcinomas.
12845325 2003 RAPL, a Rap1-binding molecule that mediates Rap1-induced adhesion through spatial regulation of LFA-1.
12676952 2003 The pro-apoptotic Ras effector Nore1 may serve as a Ras-regulated tumor suppressor in the lung.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11978988 2001 Chromosome mapping and sequence variation of the murine Ras effector gene Nore1.
11965544 2002 RASSF3 and NORE1: identification and cloning of two human homologues of the putative tumor suppressor gene RASSF1.
11864565 2002 Identification of a novel Ras-regulated proapoptotic pathway.
11857081 2002 The putative tumor suppressor RASSF1A homodimerizes and heterodimerizes with the Ras-GTP binding protein Nore1.
9488663 1998 Identification of Nore1 as a potential Ras effector.