Property Summary

NCBI Gene PubMed Count 46
PubMed Score 31.62
PubTator Score 29.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
oligodendroglioma 2.200 1.4e-02
psoriasis -1.100 4.9e-03
osteosarcoma -2.475 2.2e-03
medulloblastoma, large-cell -1.600 8.5e-03
adrenocortical carcinoma -1.622 3.2e-04
primary pancreatic ductal adenocarcinoma 1.035 1.7e-02
non-small cell lung cancer -1.913 8.1e-17
intraductal papillary-mucinous adenoma (... -1.800 3.2e-03
intraductal papillary-mucinous carcinoma... -1.900 2.5e-03
lung cancer -3.200 1.4e-05
interstitial cystitis 1.800 1.7e-03
group 4 medulloblastoma -1.500 6.8e-03
pilocytic astrocytoma 1.400 1.2e-03
primary Sjogren syndrome 2.300 5.0e-04
subependymal giant cell astrocytoma -1.754 1.6e-02
lung adenocarcinoma -1.700 5.8e-09
lung carcinoma -3.000 8.3e-32
gastric carcinoma 1.700 2.8e-02
ulcerative colitis 2.300 1.6e-05
ovarian cancer 2.400 5.2e-05

 GO Function (1)

Protein-protein Interaction (5)

Gene RIF (29)

PMID Text
26482475 our results suggest that RASSF2 may function as a tumor suppressor gene
26284587 RASSF2 gene is differently methylated in luminal and non-luminal tumors and is a promising suppressor gene with clinical involvement in breast cancer
25621889 We conclude that EPB41L3, RASSF2 and TSP-1 genes are involved in the pathogenesis of diffuse gliomas
24606436 Epigenetic inactivation of RASSF2A through aberrant promoter methylation may play an important role in the pathogenesis of epithelial ovarian cancer.
24605823 Promoter hypermethylation of RASSF2A is observed in cervical cancer, while not in normal cervical tissues.
23887284 results suggest that both RASSF1A and RASSF2 are novel epigenetically inactivated tumor suppressor genes in Ewing sarcoma and RASSF2 methylation may have prognostic implications for ES patients
23542458 our results suggest that RASSF2 potentially functions as a new tumor-suppressor gene that is inactivated through hypermethylation in cervical cancer
21792082 Promoter hypermethylation of RASSF2A is observed in pancreatic ductal adenocarcinoma, while not in normal pancreatic tissue.
21409489 Hypermethylation of RASSF2 gene is associated with advanced gastric cancer.
20920251 Results suggest that RASSF2 encodes a novel epigenetically inactivated candidate tumor suppressor gene in thyroid carcinogenesis.
20716062 Sp1-mediated RASSF2A gene transcription is activated by p300 through histone acetylation, and this activation plays an important role in inducing late apoptosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368356 Data show that RASSF2 forms a direct and endogenous complex with prostate apoptosis response protein 4 (PAR-4) and that this interaction is regulated by K-Ras and is essential for the full apoptotic effects of PAR-4.
19962960 these findings indicate that MST1 is a major determinant of RASSF2 protein stability, and suggest that RASSF2 acts in a complex manner that extends beyond simple protein-protein association to play an important role in MST1 regulation.
19773381 Tumor-specific methylation of APC, MGMT, RASSF2A, and Wif-1 genes might be a valuable biomarker in plasma for the early detection of colorectal cancer.
19555684 Data provide evidence that MAPK/ERK-2 mediated phosphorylation regulates nucleo-cytoplasmic transport and cell growth arrest activity of RASSF2.
19525978 MST2 and RASSF2 form an active complex in vivo, in which RASSF2 is maintained in a phosphorylated state and protects MST2 from degradation and turnover
19513612 Aberrant methylation of the RASSF2A gene with the subsequent loss of RASSF2A expression plays an important role in the pathogenesis of hepatocellular carcinoma.
19509163 The epigenetic silencing of tumor suppressor genes involved in the Ras/PI3K/AKT pathway plays an important role in oral squamous cell carcinoma radioresistance
18294275 epigenetic inactivation of RASSF2 plays an important role in oral squamous cell carcinoma tumorigenesis
17891178 A novel methylation marker for multiple malignancies; suppresses breast tumor cell growth in vitro and in vivo.
17549418 Aberrant methylation of the RASSF2 gene with the subsequent loss of RASSF2 expression plays an important role in the pathogenesis of lung cancers.
17320110 Transport of Ras effector superfamily proteins into the nucleus/nucleolus may play a vital role in modulating Ras-mediated cell proliferation during tumorigenesis.
17013898 Hypermethylation of the RASSF2A promoter and K-ras/BRAF mutations is associated with microsatellite-stable colorectal cancers
17013896 Inactivation of RASSF2A by promoter methylation correlates with lymph node metastasis in nasopharyngeal carcinoma
16265349 RASSF2 is silenced by hypermethylation near the transcription start site in gastric cancer
16012945 RASSF2 is a novel tumor suppressor gene that regulates Ras signaling and plays a pivotal role in the early stages of colorectal tumorigenesis.
15806169 In colonic neoplsms epigenetic (RASSF2A) and genetic (K-ras) changes are mutually exclusive and provide alternative pathways for affecting Ras signalling.
12732644 RASSF2 is a new member of the RASSF1 family of Ras effectors/tumor suppressors that exhibits a specificity for interacting with K-Ras

AA Sequence

MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQM      1 - 70
QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQL     71 - 140
MRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLN    141 - 210
KFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEM    211 - 280
PVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI                            281 - 326
//

Text Mined References (50)

PMID Year Title
26482475 2016 Aberrant hypermethylation of RASSF2 in tumors and peripheral blood DNA as a biomarker for malignant progression and poor prognosis of esophageal squamous cell carcinoma.
26284587 2015 Differential involvement of RASSF2 hypermethylation in breast cancer subtypes and their prognosis.
25621889 2015 EPB41L3, TSP-1 and RASSF2 as new clinically relevant prognostic biomarkers in diffuse gliomas.
25416956 2014 A proteome-scale map of the human interactome network.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24606436 2014 Aberrant methylation of RASSF2A in tumors and plasma of patients with epithelial ovarian cancer.
24605823 2014 Aberrant promoter methylation and silencing of RASSF2A gene in cervical cancer.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23887284 2013 RASSF2 methylation is a strong prognostic marker in younger age patients with Ewing sarcoma.
23542458 2013 RASSF2 hypermethylation is present and related to shorter survival in squamous cervical cancer.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23386615 2013 The tumor suppressor Mst1 promotes changes in the cellular redox state by phosphorylation and inactivation of peroxiredoxin-1 protein.
21792082 2012 Aberrant methylation of RASSF2A in human pancreatic ductal adenocarcinoma and its relation to clinicopathologic features.
21409489 2011 Aberrant gene methylation is a biomarker for the detection of cancer cells in peritoneal wash samples from advanced gastric cancer patients.
21269460 2011 Initial characterization of the human central proteome.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20716062 2010 Activation of RASSF2A by p300 induces late apoptosis through histone hyperacetylation.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20368356 2010 The Ras effector RASSF2 controls the PAR-4 tumor suppressor.
19962960 2010 Role of the tumor suppressor RASSF2 in regulation of MST1 kinase activity.
19773381 2009 Aberrant methylation of APC, MGMT, RASSF2A, and Wif-1 genes in plasma as a biomarker for early detection of colorectal cancer.
19555684 2009 Extracellular signal-regulated kinase 2 (ERK-2) mediated phosphorylation regulates nucleo-cytoplasmic shuttling and cell growth control of Ras-associated tumor suppressor protein, RASSF2.
19525978 2009 RASSF2 associates with and stabilizes the proapoptotic kinase MST2.
19513612 2009 RASSF2A promoter methylation in hepatitis B virus-related hepatocellular carcinogenesis and its correlation with elevated serum alpha-fetoprotein level.
19509163 2009 Methylation of RASSF1A, RASSF2A, and HIN-1 is associated with poor outcome after radiotherapy, but not surgery, in oral squamous cell carcinoma.
18294275 2008 Epigenetic inactivation of RASSF2 in oral squamous cell carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17891178 2008 Epigenetic regulation of the ras effector/tumour suppressor RASSF2 in breast and lung cancer.
17549418 2007 Epigenetic inactivation of the RAS-effector gene RASSF2 in lung cancers.
17320110 2007 Nuclear transport of Ras-associated tumor suppressor proteins: different transport receptor binding specificities for arginine-rich nuclear targeting signals.
17013898 2007 Correlation between hypermethylation of the RASSF2A promoter and K-ras/BRAF mutations in microsatellite-stable colorectal cancers.
17013896 2007 Inactivation of RASSF2A by promoter methylation correlates with lymph node metastasis in nasopharyngeal carcinoma.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16265349 2005 RASSF2, a potential tumour suppressor, is silenced by CpG island hypermethylation in gastric cancer.
16012945 2005 The Ras effector RASSF2 is a novel tumor-suppressor gene in human colorectal cancer.
15806169 2005 CpG island promoter hypermethylation of a novel Ras-effector gene RASSF2A is an early event in colon carcinogenesis and correlates inversely with K-ras mutations.
15569673 2005 Local activation of Rap1 contributes to directional vascular endothelial cell migration accompanied by extension of microtubules on which RAPL, a Rap1-associating molecule, localizes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12732644 2003 RASSF2 is a novel K-Ras-specific effector and potential tumor suppressor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11210185 2001 Isolation and molecular characterization of rasfadin, a novel gene in the vicinity of the bovine prion gene.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.