Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 18.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -2.000 1.0e-03
breast carcinoma -1.500 4.5e-14
cystic fibrosis 1.600 1.1e-02
gastric carcinoma -2.100 1.7e-02
intraductal papillary-mucinous adenoma (... 3.100 4.0e-03
ovarian cancer 2.000 4.0e-03

Gene RIF (15)

AA Sequence

MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRRRQRRSRRLGSAGDPHGPGELPEPPNE      1 - 70
DDEDDDEALPQGMLCGPPQCYCIVEKWRGFERILPNKTRILRLWAAWGEEQENVRFVLVRSEASLPNAGP     71 - 140
RSAEARVVLSRERPCPARGAPARPSLAMTQEKQRRVVRKAFRKLAKLNRRRQQQTPSSCSSTSSSTASSC    141 - 210
SSSPRTHESASVERMETLVHLVLSQDHTIRQQVQRLHELDREIDHYEAKVHLDRMRRHGVNYVQDTYLVG    211 - 280
AGIELDGSRPGEEPEEVAAEAEEAAAAPPLAGEAQAAALEELARRCDDLLRLQEQRVQQEELLERLSAEI    281 - 350
QEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEAVKSDLDYSQQ    351 - 420
QWDSKKRELQGLLQTLHTLELTVAPDGAPGSGSPSREPGPQACADMWVDQARGLAKSGPGNDEDSDTGLS    421 - 490
SMHSQDSDSLPMCESLV                                                         491 - 507
//

Text Mined References (18)

PMID Year Title