Property Summary

NCBI Gene PubMed Count 373
PubMed Score 621.27
PubTator Score 701.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 4.8e-05

Protein-protein Interaction (9)

Gene RIF (357)

PMID Text
27078152 Results indicate that hypermethylation of tumor suppressor protein RASSF1A and docking protein 1 (DOK1) contributes to hepatocarcinogenesis and is associated to clinicopathological characteristics.
26759237 RASSF1 acts to restrict EMT and invasion by indirectly controlling YAP nuclear shuttling.
26754001 Different genetic mechanisms seem to contribute to RASSF1 deregulation in this setting, but RASSF1 methylation does not seem to substantially affect RASSF1 isoforms expression.
26648328 RASSF1C gene is not involved in Clear-cell renal cell carcinoma (ccRCC)progression and we propose that the measurements of RASSF1A mRNA levels in paired tumor-normal kidney tissue could serve as a new prognostic factor in ccRCC
26549256 Distinct RASSF1 isoforms have opposing functions, which provide a biomarker for YAP1 activation and explain correlations of RASSF1 methylation with advanced invasive disease in humans.
26482848 RASSF1A promotes the translocation of cytosolic PRMT5 to microtubules.PRMT5 co-localizes with RASSF1A on stabilized microtubules.
26392358 Data indicate tumor suppressors TP73, RASSF1A, MLH1 and BRCA1 as possible biomarkers to distinguish Pleomorphic invasive lobular cancer (pleomorphic ILC} from classic ILC and infiltrative ductal cancer (IDC).
26370119 Tumor-adjacent tissues showed higher methylation status of RASSF1A, HIN-1 and MGMT promoters.
26320446 Interaction between HPV infection and RASSF1A promoter methylation is associated with the development of cervical cancers.
26269600 MOAP-1 is a tumor suppressor protein linked to the RASSF1A protein
26182870 RASSF1A promoter gene methylation is highly associated with non-small cell lung cancer and disease progression.
26158424 Existing evidence for association of RASSF1A hypermethylation with characteristics indicative of more invasive tumors. [Review]
26125908 Lacrimal gland carcinoma patients with lower RASSF1 expression showed a higher recurrence probability, indicating unfavorable prognosis.
26112163 In lung neoplasm samples there was decreased expression of RASSF1A mRNA.
26107221 Hypermethylation of RASSF1A gene was associated with the increased risk of Renal Cell Carcinoma.
26073472 RASSF1 promoter methylation was found in 68.5% of stomach cancer patients. It correlated positively with lymphatic metastasis.
26041820 Data show that the tumor suppressor RASSF1A is a direct target of the PML/RARalpha-regulated microRNAs miR-181a/b cluster.
26019036 A partially methylated or unmethylated RASSF1A promoter as well as elevated serum AFP level or methylation of p21 in addition to elevated serum AFP level might be associated with poor prognosis in patients with hepatocellular carcinoma.
25927241 RASSF1A tumor suppressor regulates BRCA2 at stalled replication forks.
25891176 BSP demonstrated that emodin, to a certain degree, affected the demethylation of tumor-suppressor genes P16, RASSF1A, and ppbspENK in the pancreatic cancer cell line PANC-1.
25886188 Hypermethylation of RASSF1A gene promoter is associated with esophageal squamous cell carcinoma.
25824751 RASSF1A gene methylation is associated with nasopharyngeal carcinoma risk.
25805039 Hypermethylation at promoters of RARB, BRCA1, and RASSF1A is associated with reduced transcript levels of the respective gene in primary breast cancer tissue samples.
25703593 Data suggest that methylation of RASSF1A gene promoter is up-regulated in placenta from pregnancies complicated by intrauterine growth retardation as compared to pregnancies with appropriate growth for gestational age.
25556469 There was a significant relationship between RASSF1A promoter methylation and lung cancer risk. This relationship was stronger in NSCLC than in SCLC. [Meta-Analysis]
25514805 Hypermethylation of RASSF1 was associated with esophageal squamous cell carcinoma.
25483734 epigenetic silencing of RASSF1A is frequently caused by promoter hypermethylation in gastric cancer cell lines as well as in gastric adenocarcinoma tissues, which may contribute to gastric carcinogenesis.
25368379 As RASSF1A modulates both apoptotic DDR and XPA-mediated DNA repair, it may coordinate the balance between repair and death after DNA damage
25339045 RASSF1A gene hypermethylation is associated with lung cancer.
25302792 RASSF1A methylation is involved in the development, differentiation and progression of ACC and is a strong independent biomarker of poor survival in ACC patients in a Chinese population.
25229773 Silencing of RASSF1A and concurrent NF-kappaB activation shows that a subset of follicular thyroid hyperplasia (FTH) shares epigenetic changes and downstream signaling events associated with malignant lesions;FTH may potentially be a premalignant lesion.
25225292 cell cycle/microtubule effects of RASSF1A are key to its tumor suppressor function rather than its apoptotic effects
25218637 Data indicate that tumour suppressor RASSF1A triggers large tumor suppressor kinase 1 (LATS)-CDK2 interaction and restricts CDK2 kinase activity towards BRCA2.
25152984 Promoter methylation of RASSF1A is a marker of marked fibrosis in chronic hepatitis C.
25053593 Our meta-analyses identified strong associations of four aberrantly methylated genes (GSTP1, RASSF1, p16, and RARB) with Prostate cancer
25040980 The total frequency of FHIT, RASSF1A and RARbeta gene methylation was significantly higher in lung cancer.
25038505 Malignant peripheral nerve sheath tumor samples display hypermethylation of the RASSF1A gene promoter. This is the first molecular marker that if validated can characterize a subgroup of patients with inferior prognosis, restricted to those with NF1.
25007054 IGFBP-5 may be a negative modulator of RASSF1C/ PIWIL1 growth-promoting activities.
24998565 High methylation level of RASSF1A gene promoter region is associated with low drug sensitivity of non-small cell lung cancer.
24980613 Hypermethylation of RASSF1 in cancerous tissue and urine from patients with prostate cancer correlated with biochemical recurrence after radical prostatectomy.
24935575 This meta-analysis suggests a significant association between RASSF1A methylation and esophageal squamous cell carcinoma.
24870779 This meta-analysis suggests, for the first time, that RASSF1A Ala133Ser polymorphism may contribute to cancer susceptibility, especially for lung cancer. [Meta-Analysis]
24756244 Decreased expression of RASSF1A and up-regulation of RASSF1C is associated with esophageal squamous cell carcinoma.
24747657 DNA methylation of GSTP1, APC and/or RASSF1 in initial, histopathologically cancer negative biopsies serves as a significant independent predictor of the presence of unsampled PCa.
24732797 Characterization of the consequences of RASSF1A loss on epithelial cell proliferation revealed that RASSF1A expression suppresses both microRNA 21 (miR-21) expression and extracellular signal-regulated kinase 1/2 (ERK1/2) activation.
24680815 RASSF1A methylation in neuroblastoma may have two biological roles based on the ploidy status and patient's age.
24665911 findings indicated that abnormal RASSF1A promoter methylation may be strongly correlated with the pathogenesis of ovarian cancer
24621386 Meta-analysis reveals that the frequency of RASSF1A gene promotor-region methylation in cancer tissues was significantly higher than that in benign, adjacent, and normal tissues.
24598366 RASSF1A hypermethylation in sputum samples is elevated in lung cancer compared with controls.
24573512 RASSF1A promotes apoptosis and suppresses the proliferation of ovarian cancer cells
24510557 Fetus-derived RASSF1A levels were 2.03 fold higher in pre-eclamptic subjects.
24505629 frequent PIK3CA amplification and promoter methylation of RASSF1A and PAX6 genes in gastric cancers
24478455 Microtubule segment stabilization by RASSF1A is required for proper microtubule dynamics and Golgi integrity.
24464006 RASSF1 gene methylation could serve as a prognostic factor of endometrial carcinogenesis and could help to predict the behaviour of endometrial hyperplasia.
24460357 High methylation frequency of RASSF1A was significantly associated with epithelial ovarian cancer.
24383114 RASSF1A methylation differs in papillary thyroid carcinoma compared with normal thyroid, is associated with multifocality, and is inversely correlated with extracapsular invasion.
24353088 suggested that RASSF1A promoter methylation was significantly associated with an increased risk for prostate cancer
24253900 RASSF1A methylation in serum showed high degree of concordance with methylation in breast cancer tissues.
24248815 RASSF1A expression variation does not participate in the pathogenesis and the progression of acute myeloid leukemia
24247422 RASSF1A expression is downregulated in HBV-related HCC. HBx suppressed RASSF1A expression via DNMT1.
24197116 CHK1-mediated phosphorylation of RASSF1A, at Serine 184, plays an important role in cell-cycle regulation and mutation of this CHK1 phosphorylation site in nasopharyngeal carcinoma has disease relevance.
24116157 Results suggest that RAS association domain family protein 1a gene (RASSF1A) promoter methylation had a strong association with ovarian cancer.
24073258 RASSF1A promoter methylation is associated with high Gleason score in prostate cancer.
24068440 The results indicate that aberrant CpG methylation of the promoter region in the GSTP1 and RASSF1A tumor-suppressor genes is an important event in carcinogenesis of endometrial cancer and may have an impact on tumor aggressiveness.
24001151 Mahanine treatment induces the proteasomal degradation of DNMT1 and DNMT3B via the inactivation of Akt, which facilitates the demethylation of the RASSF1A promoter and restores its expression in prostate cancer cells.
23990798 these results demonstrate a novel mechanism of epigenetic repression of the RASSF1A tumor suppressor gene involving antisense unspliced lncRNA, in which ANRASSF1 selectively represses the expression of the RASSF1 isoform
23989600 RASSF1A methylation is a significant prognostic indicator in hepatoblastomas, and it may become a promising molecular marker to stratify patients into appropriate risk groups.
23982879 This study identified a strong association between RASSF1A promoter methylation and risk of gastric cancer and highlighted a promising potential for RASSF1A promoter methylation in gastric cancer risk prediction.
23979608 the impact of Glutamate carboxypeptidase II (GCPII) haplotypes on the expression of PSMA, BNIP3, Ec-SOD, GSTP1 and RASSF1 genes were elucidated to understand the epigenetic basis of oxidative stress and prostate cancer risk.
23915220 Downregulation of RASSF1A via promoter hypermethylation may play a role in the malignant progression of adrenocortical carcinoma possibly by abrogating differentiation-promoting RASSF1A- microtubule interactions.
23902976 GPR56, MT1G, and RASSF1 might be the potential methylation markers associated with acquired multidrug resistance of lung adenocarcinoma.
23891964 These specific roles are highly relevant with cardiac hemodynamics and therapeutic strategies, indicating RASSF1A may have the potential to reverse pathological cardiac hypertrophy thus prevent heart failure fundamentally.
23891693 RASSF1A promoter methylation in hepatocellular carcinoma does not appear to have a role in prognosis
23888343 In breast cancer, the mean methylation intensity of RASSF1 was 42.5% and 48.6% according to high-resolution melting and quantitative methylation-specific polymerase chain reaction, respectively.
23887284 results suggest that both RASSF1A and RASSF2 are novel epigenetically inactivated tumor suppressor genes in Ewing sarcoma and RASSF2 methylation may have prognostic implications for ES patients
23886171 RASSF1A promoter methylation is associated with non-small cell lung cancer.
23865079 loss of RASSF1A may be involved in pathogenesis of colorectal cancer (CRC), its expression was found predominantly in K-ras wild-type CRCs.
23705663 alterations of RASSF1A may play an important role in gastric cardia carcinogenesis and may probably also be involved in esophageal squamous cell carcinogenesis.
23594797 These findings provide mechanistic insight into the regulation of YAP and AREG by RASSF1A in human multistep hepatocarcinogenesis.
23579583 A significant increase in the circulating hypermethylated RASSF1A gene sequence levels was observed in the pregnancies complicated by ICP as compared with normal pregnancies.
23526657 Levels of both cell free and cell free fetal RASSF1A DNA in the first trimester, can be used to predict women at risk to develop preeclampsia.
23320751 Tumor-specific methylation of the three-gene panel (ITIH5, DKK3, and RASSF1A) might be a valuable biomarker for the early detection of breast cancer.
23319821 Hypermethylation of RASSF1A was associated with non-small cell lung cancer.
23192464 Aim of this work is to provide a detailed comparison of clinical-pathologic features between well-differentiated and poorly differentiated tumors according to their BRAF and RASSF1A status.
23187089 Hypermethylated RASSF1A in maternal plasma may be useful as a potential biomarker to detect placental-mediated pregnancy complications, regardless of fetal gender and polymorphism.
23147544 Less intensive doses of cisplatin and docetaxel are active but not effective in reducing toxicity; Also, both ERCC1 and RASSF1A might be useful prognostic markers in this regimen.
23139773 This study showed that RASSF1A methylation appears to be an independent prognostic factor for bladder cancer.
23128528 DNA methylation of the RASSF1A is associated with colorectal cancer.
23055343 The aim of this study was to assess the extent of methylation of the RASSF1A and APC TSG promoters in ovarian epithelial cancers
23038753 results reveal a novel function for p53 in the methylation of RASSF1A promoter by its interaction with DAXX
23009572 Methylation of RASSF1A promoter is independent of the prognosis for Taiwanese CRC patients.
22766745 these data indicated that methylation of the RASSF1A promoter region is an early event during hepatocellular carcinoma development.
22733432 RASSF1A methylation has been associated with colorectal cancer development. [Review]
22716213 Galectin-1 may play a role in RASSF1A signaling in a gastric neoplams cell line.
22695491 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancers was associated with clinical characteristics, but only RASSF1A methylation was associated with time to first recurrence and overall survival.
22694820 In papillary thyroid cancer, significant correlations between the methylation status of the RASSF1A gene and the V600E BRAF mutation were found.
22670522 RASSF1A expression alterations were tumor specific.
22615811 results of this meta-analysis suggest that RASSF1A promoter hypermethylation confers a higher risk of relapse and a worse survival in patients with breast cancer
22591718 Findings suggest the role of RASSF1C/PIWIL1 proteins in initiation and progression of lung cancer.
22581300 hypermethylated RASSF1A is an important modulating factor for the efficacy of docetaxel-based chemotherapy in breast cancer.
22520501 This study identifies associations between RASSF1A polymorphism and survival in carcinoma renal clear cell.
22447862 RASSF1A apparently has an important role in the development of uveal melanoma, and its reactivation might be applied in the development of new treatments.
22446336 Study demonstrated that reduced RASSF1A mRNA expression might play a role in early bladder tumorigenesis. Reduced RASSF1A mRNA expression correlates with aggressive pathologic features.
22394463 the Ser133 allele of RASSF1A Ala133Ser polymorphism may be a genetic susceptibility factor for hepatocellular carcinoma in the Turkish population
22389451 Findings propose a model that suggests a certain subset of the population have inherently weaker p73/p53 activation due to inefficient signaling through RASSF1A, which affects both cancer incidence and survival.
22382007 RASSF1A methylation was associated with advanced tumor stage and high grade in nonmuscle invasive bladder cancer
22332908 RASSF-1alpha methylation and PGE2 expression decreased with increasing levels of serum trans-resveratrol in women at increased risk for breast cancer.
22315090 Promoter methylation status analysis of hereditary breast tumors revealed high methylation frequencies for the three genes (67% RASSF1A, 80% SLIT2, and 72% WIF1).
22297548 Associations between RASSF1A and CDH1 methylation levels and clinico-pathological parameters manifested various levels of RASSF1A and CDH1 promoter methylation.
22266866 RASSF1A has a key role in suppressing the transformation of human breast epithelial cells and estrogen receptor alpha positive breast cancer initiation.
22246327 Report promoter methylation of tumor suppressor gene RASSF1A in head and neck squamous cell carcinoma. Demethylation reduces proliferation of head and neck squamous carcinoma cells.
22232300 recombined plasmid pEGFP-C1-TFPI-2 actually interacted with native RASSF1C
22172412 AflatxonB1/ polycyclic aromatic hydrocargon DNA adducts may be associated with RASSF1A hypermethylation in hepatocarcinogenesis. RASSF1A methylation status may not be a proper predictor of overall survival for HCC.
22142825 RASSF1a(M) is a novel, highly specific DNA marker for minimal residual disease detection in neuroblastoma
22139571 Chromatin immunoprecipitation using antibodies against the acetylated and trimethylated lysine 9 of histone H3 demonstrated low levels of histone methylation in these genes, which are located closest to RASSF1.
21955482 Serial serum specimens taken over the course of treatment for 8 of 9 patients showed fluctuations in RASSF1A methylation concomitant with disease status in ovarian cancer.
21910689 The present study reveals a novel regulation of RASSF1C and the potentially important role of RASSF1C in DNA damage responses via SCFbeta-TrCP and Mule.
21884695 methylated RASSF1A in plasma is an independent prognostic factor for overall survival (hazard ratio=3.262, 95% CI: 1.476-7.209, P=0.003)of patients with hepatocellular carcinoma
21873787 The methylation status of RASSF1A can influence the clinical efficacy of neoadjuvant therapy in patients with advanced epithelial ovarian cancer.
21868547 findings provide further evidence on the usefulness of RASSF1A methylation status as an informative prognostic biomarker in BC in a Saudi population
21838870 RASSF1A gene methylation in pancreatic endocrine tumor is higher than normal pancreas in no more than 75% of cases and as such it cannot be considered a marker for this neoplasm.
21822036 RASSF1 was methylated in 71% (24 of 34)of early stage prostate cancer; may be selected as noninvasive tumor biomarker
21809394 RASSF1A deletion/methylation is associated with cervical intraepithelial neoplasia.
21788308 these data show that depletion of RASSF1A could be an early event observed during senescence of normal uveal melanocytes and that additional alterations are acquired during malignant transformation to uveal melanoma.
21722812 RASSF1A gene hypermethylation at the promoter is associated with the progression of esophageal squamous cell carcinoma
21660959 RASSF1A is down-regulated in melanoma tissues as well as cell lines.
21624251 Laryngeal tumor suppressor gene RASSF1A promoter methylation is a key factor down-regulating gene expression.
21489991 a role for Salvador as a human tumor suppressor and RASSF1A effector and show that Salvador allows RASSF1A to modulate p73 independently of the hippo pathway.
21473856 RASSF1A has a tumor suppressive effect as a modulator for ROS production induced by oncogenic K-Ras.
21473137 5-Aza-dC and TSA can improve RASSF1A expression by reversing DNA methylation and histone deacetylation in Hep-2 cells.
21468893 Rap1A binds the tumor suppressor Ras association domain family 1A (RASSF1A) in a manner that is regulated by phosphorylation of RASSF1A
21450690 HCVc could upregulate the methylation status of the RASSF1A promoter through regulation of SMYD3, and histone methylation may affect the DNA methylation of downstream gene by an unknown mechanism
21364923 TP53 protein specifically binds to the RASSF1A promoter and inhibits its expression.
21338215 Promoter hypermethylation of RASSF1A is associated with hepatocarcinogenesis.
21274674 High frequency of methylation at MGMT, RASSFA, and HIC-1 was detected in colorectal carcinoma patients
21221769 Methylated RASSF1A and PITX2 in PB-P appear to have promising potential as prognostic markers in clinical use.
21205828 the CUL4A.DDB1 E3 complex is important for regulation of RASSF1A during mitosis, and it may contribute to inactivation of RASSF1A and promoting cell cycle progression
21199877 Through binding to MST1/2, RASSF1A supports maintenance of MST1/2 phosphorylation, promoting an active state of the MST kinases and favoring induction of apoptosis.
21156971 RASSF1A promoter hypermethylation is associated with non-small cell lung carcinoma.
21134643 Structural characterization of the DAXX N-terminal helical bundle domain and its complex with Rassf1C.
21115918 Highest frequencies of DNA methylation in RASSF1A gene were found in head and neck squamous cell tumours with aneuploidy.
21036752 RASSF1 A/E is likely to act as a tumor suppressor gene in most pulmonary NET, and RASSF1 C as an oncogene in high-grade tumors.
20955597 RASSF1C, unlike RASSF1A, is not a tumor suppressor, but instead may play a role in stimulating metastasis and survival in breast cancer ce
20877461 CTCF bound to insulator sequences located between BLU and RASSF1A.
20864173 Data show that methylation of at least one gene was detected in 18 patients (45%), the genes methylated were CDKN2B (20%), RASSF1 (18%), RARB (10%), CDH13 (7.5%) and FHIT (5%).
20842524 RASSF1A high-methylation levels are independent predictors of worse outcome in breast cancer.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20800513 Hypermethylation of RASSF1A is associated with recurrence of bladder cancer.
20697344 Our results demonstrate a role for RASSF1A microtubule localization in eliciting its tumor suppressor function
20677556 The hypermethylation of the RASSF1A promoter may be an independent prognostic factor of NSCLC after operation.
20668305 Promoter regions of RASSF1 are modified by soy estrogens in prostate cancer cells.
20535589 We investigated the utility of a set of four independent genes (P16, TSHR, RASSF1A and RARbeta2) promoter hypermethylation analysis as a diagnostic or prognostic tool in papillary thyroid tumors
20505321 The methylation levels and frequencies of HIN1, RASSF1A and TWIST, and average MR were significantly lower in basal-like subtype compared to luminal or human epithelial growth factor receptor-2 subtype.
20497257 Our results indicate that the effects of 5-aza-dC on histone methylation profiles are gene-specific and that aberrant histone modifications may serve as a principal means of misregulation of RASSF1A and POU5F1 expression in testis cancer.
20496080 HIN-1, RAR-beta, RASSF1A, and Twist had the ability to distinguish high-grade squamous intraepithelial lesions/squamous cell carcinomas from low-grade squamous intraepithelial lesions/negative cervical scrapings
20471512 Epigenetic alterations by methylation of RASSF1A promoter sequences are associated with mammary carcinoma.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20361264 the RASSF1A p.A331S polymorphism is not confirmed as a significant germline contributor to familial breast cancer susceptibility.
20361264 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20360646 Promoter hypermethylation of RASSF1A, p16, and DAPK genes was detected in lung cancer.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20208994 the promoter region is frequently hypermethylated in the APC and RASSF1A tumour suppressors in parathyroid tumours
20193080 tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A are downregulated in primary non-small cell lung cancer
20184324 Studies indicate that small molecules with the ability to restore RASSF1A expression may represent a new class of therapeutic agents.
20146887 There was no association between MTHFR gene variants and methylation status of the RASSF1A gene in the 45 bladder cancer patients.
20140873 Hypermethylated RASSF1A gene in pre-eclampsia plasma was significantly increased.
20086174 Data show T117/T384 as Akt phosphorylation sites in MST2, and mutation of these sites inhibited MST2 binding to Raf-1 but enhanced binding to RASSF1A, accentuating downstream c-jun N-Terminal Kinase and p38 MAPK signaling and promoting apoptosis.
20079060 As2O3 can activate the expression of RASSF1A gene to inhibit the cell cycle progress of nasopharyngeal carcinoma cell line CNE-2Z.
20075396 Significantly different methylation levels of the RASSF1 gene were found between placenta (normal and preeclamptic) and plasma samples of pregnant women.
20069457 RASSF1A-mediated cell death is, therefore, tightly controlled by 14-3-3 association.
20056647 An association was seen for women known mutation in BRCA1 or BRCA2 who developed breast cancer on study and RASSF1A methylation
20042089 Expression of RASSF1A is down-regulated in nasopharyngeal carcinoma due to the hypermethylation of promoter
20038516 High levels of methylation in the RASSF1A promoter were significantly more frequent in grade 3 compared with grade 1 or 2 tumors (P = 0.028) and in patients with stage III or IV compared with patients with stage I or II
19962312 A novel DNA damage pathway emanating from ATM that is frequently disabled in tumors via epigenetic silencing of RASSF1 or mutation of an ATM phosphorylation site is reported.
19957692 RASSF1A promoter hypermethylation was frequently present in retinoblastoma.
19940364 Promoter hypermethylation was observed in PRB 67%, ERalpha 64%, RASSF1A 63%, p16INK4A 51%, RARbeta2 22%, GSTP1 25% and BRCA1 27% of the breast cancers, respectively.
19887622 Our findings implicate Aurora B-mediated phosphorylation of RASSF1A in the regulation of cytokinesis.
19854132 RASSF1A silencing strongly correlates with overexpression of HOXB3 and DNMT3B.
19821102 RASSF1 Ala133Ser genotype increased the risk of lung cancer.
19821102 Observational study of gene-disease association. (HuGE Navigator)
19799084 Loss of expression of RASSF1A and TPO mRNA are closely related to the development of thyroid papillary carcinoma.
19795445 Hypermethylation of RASSF1 was significantly associated with shorter time to recurrence of nonsmall cell lung cancer.
19761124 inactivation of the RASSF1A gene due to hypermethylation in the promoter region might play a critical role in the pathogenesis of ovarian cancers
19727727 RASSF1A were comparable in patients with Monoclonal gammopathy of undetermined significance (MGUS) and with multiple myeloma (MM).
19657672 Findings suggested that aberrant methylation of RASSF1A occurs frequently in Tunisian breast cancer patients compared with others. Furthermore, RASSF1A hypermethylation could be used as a potential marker of poor prognosis.
19652091 data establish RASSF1A as a novel inhibitor of cardiac hypertrophy by modulating the extracellular regulated kinase 1/2 pathway.
19637319 RASSF1A is frequently methylated in Ewing sarcoma
19578875 Data showed that RASSF1A methylation was observed in 10 (47.6%) of 21 synovial sarcomas.
19548529 significant correlation between RASSF1A methylation events and allelic losses in the close polymorphic marker was shown here, pointing to the role of "two hit" model for this tumor-suppressor gene inactivation in RCC
19509163 The epigenetic silencing of tumor suppressor genes involved in the Ras/PI3K/AKT pathway plays an important role in oral squamous cell carcinoma radioresistance
19506903 Methylated state of this set of genes may be more specific to the late rather than the early stage of NSCLC.
19478941 This is the first report of high frequencies of somatic mutations in RASSF1 and RBSP3 in different cancers suggesting it may underlay the mutator phenotype of cancer.
19473831 results show a high frequency of hypermethylation of the RASSF1A promoter and occurrence of Merkel Cell PolyoVirus infection in the tumour tissue of Small Cell Lung Cancer.
19470737 Results show that cumulative RASSF1A, TWIST1, and HIN1 gene methylation accurately distinguished ducts with cancerous versus benign lesions.
19454503 results have confirmed that BRCA1, RASSF1, GSTP1 and EPHB2 promoter methylation was found in each prostate cancer sample
19450668 Data in this report indicated that UV irradiation suppressed RASSF1A gene expression and this down-regulation is mediated by the decrease in the in vivo binding of Sp-proteins on the GC-boxes within the RASSF1A promoter.
19374895 RASSF1A promoter methylation provides important prognostic information in early stage breast cancer patients.
19366060 methylation in the promoter region 2 of RASSF1A is likely associated with tumorigenesis of cervical squamous cell carcinoma in Uigur women.
19326371 Frequent hypermethylation of RASSF1A and the presence of Merkel cell polyomavirus contribute to the pathogenesis of Merkel cell carcinoma.
19276349 RASSF1A phosphorylation on serine 203 was up-regulated in Aurora A-overexpressing human tumors.
19223555 RASSF1A can mediate cell cycle arrest and senescence in human cancer cells by p53-independent regulation of p21(Cip1/Waf1).
19221469 Results showed that the inactivation of RASSF1A, RARbeta2 and DAP-Kinase by hypermethylation is a key step in NPC tumorigenesis and progression.
19193434 RASSF1A methylation does not appear to represent a critical step in the pathogenesis and/or the progression of CML.
19181545 Hypermethylation of E-cadherin, p14 or RASSF1A in urine sediment DNA is a potential biomarker for detecting superficial, low grade cancer
19172108 Study of 5-Aza-CdR (decitabine) on transcription regulation of RASSF1A gene in the BIU87 cell line.
19165202 Promoter hypermethylation of RASSF1A in serum DNA is associated with neuroblastoma
19160099 Aberrant CpG island hypermethylation of RASSF1A in gastric cardia adenocarcinoma.
19148529 of promoter hypermethylation of TIMP3, CDH1, DAPK, RASSF1A, p16INK4A and MGMT, only the epigenetic silencing of TIMP3 and CDH1 predicted a better outcome in head and neck squamous cell carcinoma
19145506 Demethylating agent 5-Aza-CdR can regulate demethylation and re-expression of RASSF1A gene in gastric cancer cell line SGC7901,and inhibit its growth.
19140316 Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer
19118008 NORE1B suppresses replication and transformation of cells as effectively as RASSF1A and is a putative tumor suppressor gene. NORE1B interacts with RASSF1A and loss of one of these may lead to uncontrolled growth and transformation of hepatocytes.
19098985 Data show that degradation by calpains is a novel mechanism for downregulation of NORE1A and RASSF1A proteins and might be the mechanism allowing cancer cells to escape growth suppression.
19062280 findings identify NDR1/2 as novel proapoptotic kinases and key members of the RASSF1A/MST1 signaling cascade
19024105 role of deltaDNMT3B4/2 in regulating RASSF1A promoter-specific DNA methylation in non-small cell lung cancer.
18824877 Aberrant methylation of RASSF1A and RARbeta was associated with muscle-invasive and high-grade bladder cancer.
18822131 While most tumors demonstrate a loss of RASSF1A protein, a subset of tumors was identified to exhibit substantial RASSF1A protein expression and show increased tumor progression.
18799029 Wild type RASSF1A expression could induce G1 phase arrest in QGY-7703 cells, which is accompanied by a down-regulation of Cyclin D1 protein expression through a post-transcriptional mechanism.
18788633 Hypermethylated RASSF1A promoter is frequently found in the serum DNA of non-small cell lung cancer patients.
18783461 Promoter region methylation of RASSF1A genes is an early event in endometrial carcinogenesis.
18691570 The significant difference in methylation of RASSF1A observed in the liver neoplasms and liver cirrhosis was not observed in the plasma samples.
18679651 Preliminary expression analysis indicates that RASSF1A could be involved in early tumorigenesis. Our results support the hypothesis that age and other lifestyle-dependent factors may influence promoter methylation of specific genes.
18641684 RASSF1A may function as a scaffold to bring together Aurora-A and its activator(s).
18616639 ninety-two percent of glioma tumor samples were methylated for RASSF1A, 30-57% for BLU and 47% for MGMT, suggesting promoter methylation of these genes to be a common event in glioma tumorigenesis
18608185 Study indicates a correlation between the promoter methylation of FHIT and RASSF1A genes and the clinical stage and histological grading of cervical carcinoma in Indian women.
18592002 RAS signaling in colorectal carcinomas through alteration of RAS, RAF, NF1, and/or RASSF1a.
18566590 RASSF1A associates with MDM2 and death-domain-associated protein (DAXX) in the nucleus, thereby disrupting the interactions between MDM2, DAXX, and the deubiquitinase, HAUSP, and enhancing the self-ubiquitin ligase activity of MDM2.
18538349 The promoter methylation status of a panel of critical growth regulatory genes, RASSF1A, RARbeta2, BRCA1 and HOXA5, in 54 breast cancers and 5 distant normal breast tissues of Indian patients, was analyzed.
18537155 Multivariate analysis identified RASSF1A methylation to be a promising molecular-genetic marker to predict the treatment outcome and may be used to stratify patients.
18514071 These findings indicate that PKC phosphorylation of RASSF1A regulates its ability to reorganize the microtubule network.
18494062 Aberrant CpG island methylation within the promoter region of RASSF1A is a promising biomarker for gastric and colorectal cancer.
18483325 RASSF1A methylation increases between ages 33 and 54 and was significantly positively correlated with breast cytologic atypia and breast cancer fisk.
18474619 The association of RASSF1A and MOAP-1 with death receptors involves an ordered recruitment to receptor complexes to promote cell death and inhibit tumor formation.
18469797 reduced expression of RASSF1A may play a role in endometrial carcinogenesis
18425370 analysis of promoter methylation of the RASSF1A gene in sporadic breast cancers in Chinese women
18358501 RASSF1A hypermethylation is associated with hepatocellular carcinoma
18349282 Methylation of RASSF1 was present in 80% of NSCLC tissues but only in 14% of noncancerous tissues.
18347058 inhibition of cell cycle progression in normal epithelial cells upon RASSF1A depletion despite elevated cyclin D1 concentrations
18337602 Methylation of the promoter region of RASSF1A in patients with stage I NSCLC treated with curative intent by means of surgery is associated with early recurrence.
18336597 the epigenetic inactivation of TSP-1 and RASSF1-A genes is associated with pathological variables and seems to be of prognostic significance in penile cancer.
18330258 Procaine could inhibit cell growth and up-regulate the expression of RASSF1A mRNA in nasopharyngeal carcinoma.
18322962 Over-expression of RASSF1A inhibits the growth of SGC7901 cells by negatively regulating the AP-1 activity, the latter in turn negatively signals cell proliferation.
18313166 RASSF1A promoter polymorphisms affect RASSF1A expression, further contributing to the genetic susceptibility to lung cancer.
18313166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18286482 Combined BubR1 protein down-regulation and RASSF1A hypermethylation might be implicated in the formation of chromosomal changes found in Wilms tumors.
18182852 These results suggest that downregulation of RASSF1A expression by DNA hypermethylation may be involved in gallbladder carcinogenesis.
18172292 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18172292 The presence of the RASSF1A A133S polymorphism is associated with breast cancer pathogenesis in general and modifies breast cancer age of onset in BRCA1/2 mutations carriers.
18086755 the common cancer risk factors age and adiposity enhance RASSF1A promoter methylation in nonmalignant kidney tissue.
18071316 Skp2-mediated degradation of RASSF1A plays an important role in cell proliferation and survival.
18058812 No field effect, defined as absence of epigenetically transformed cells, for GSTP1 was observed, whereas APC, RARbeta2, and RASSF1A showed a field effect up to 3 mm from the malignant core in three prostatectomy samples.
17994635 The median concentrations of hypermethylated RASSF1A (Ras association domain family 1) were 4.3-fold higher in maternal plasma of pre-eclamptic subjects than in controls, with no difference in placental tissues.
17967182 Results identified RASSF1 loci showing significant differential DNA methylation levels between tumor and non-tumor lung and highly significant hypermethylation in adenocarcinoma.
17960617 Promoter hypermethylation of RASSF1 alpha is associated with prostate cancer progression
17920725 The methylation frequency in malignant pleural mesothelioma is 20.2%. Methylation did not correlate to outcome but to improved survival in unmethylated malignant pleural mesothelioma with extrapleural pneumonectomy.
17899687 inactivation of the RASSF1A gene seems to be an important step in the tumorigenesis of PNET of the central nervous sytem
17889669 These results describe an MST2-dependent effector pathway for RASSF1A proapoptotic signaling and indicate that silencing of RASSF1A in tumors removes a proapoptotic signal emanating from p73.
17720308 Down-regulated expression of RASSF1A showed a significant association with WHO grade, tumor status, and lymph node metastasis, showing its possible utility as a biomarker for clinical specimens.
17698033 mahanine can reverse an epigenetically silenced gene, RASSF1A in prostate cancer cells by inhibiting DNMT activity that in turn down-regulates a key cell cycle regulator, cyclin D1
17695396 genetic alterations in the methylation status of p73 or RASSF1A along with 1p LOH may result in the malignant transformation of a meningioma
17683489 RASSF1A expression inhibits the growth of hepatocellular carcinoma from Qidong County.
17668224 hypermethylation of RASSF1A was associated with negative cyclin D1 expression in a series of 21 vestibular schwannomas.
17645803 The major subtypes of renal epithelial neoplasms display differential aberrant CDH1, PTGS2, and RASSF1A promoter methylation levels. This gene panel might contribute to a more accurate discrimination among common renal tumors.
17634119 Data support the hypothesis that RASSF1A is involved in early tumorigenesis of renal cell carcinoma.
17608924 Expression of RASSF1A was reduced in tissue of gastric cancer at mRNA and protein levels. Diminished expression of RASSF1A was associated with the promoter methylation.
17606310 the hypermethylation of RASSF1A gene is a useful biomarker to predict the prognosis in non-small cell lung cancer
17598981 There is no interaction between RASSF1A and Cdc20.
17563743 Aurora-A-mediated phosphorylation of RASSF1A is a novel mechanism that regulates the ability of this tumor suppressor to interact with microtubules and modulate M-phase cell cycle progression.
17538946 our results suggest that alteration of the Sav-RASSF1-Hpo tumor suppressor pathway may occur through hypermethylation of the CpG island promoter of MST1, MST2 and/or RASSF1A in human sarcomas.
17526942 methylation may play important role in progression and metastasis of small bowel carcinoid tumors
17523078 Promoter hypermethylation of RASSF1 was observed.
17477876 results showed RASSF1A & DAPK genes' promoter methylation occurred frequently in lung tumors, although prevalence of this alteration in these genes was not associated with smoking status of the patients or occurrence of mutations in K-ras, p53 & EGFR
17473182 This is the first report suggesting that reduced histone acetylation or H3K4me2 methylation and increased dimethyl-H3-K9 methylation play a critical role in the maintenance of promoter DNA methylation-associated RASSF1A gene silencing in prostate cancer.
17444856 RASSF1A was inactivated in SMMC-7721 cell line by epigenetic hypermethylation, and reintroduction of RASSF1A reduced the resistance to some anticancer drugs and inhibit the growth of cancer cells.
17379520 Study reports that complexes consisting of RASSF1A, MST2, WW45 (the human ortholog of Sav), and LATS1 exist in human cells.
17360030 findings show that RASSF1A hypermethylation and KRAS mutations and BRAF mutations are inversely correlated and play an important role in the development of cervical adenocarcinomas
17342751 Methylation of the RASSF1A gene is present in both pre-malignant and benign prostatic epithelia.
17320110 Transport of Ras effector superfamily proteins into the nucleus/nucleolus may play a vital role in modulating Ras-mediated cell proliferation during tumorigenesis.
17251440 These data show that RASSF1a methylation is a common epigenetic event in uveal melanoma development.
17170014 high frequency RASSF1A methylation observed in endometrioid endometrial carcinoma; no association was observed with the development of recurrent disease
17099724 Downregulation of RASSF1A expression by Epstein-Barr latent membrane protein 1 may facilitate its role in transformation of premalignant nasopharyngeal epithelial cells into cancer cells.
17064406 Promoter hypermethylation of RASSF1A occurs at a high frequency in neuroblastomas.
16951144 Forty-two of 46 (91%) lung tumors with RASSF1A promoter methylation expressed DNMT3B4 compared with only 13 of 73 (18%) tumors without the promoter methylation.
16937357 RASSF1A methylation may be a novel molecular-genetic marker for treatment outcome in hepatoblastoma if confirmed by studies examining a larger number of hepatoblastomas.
16918136 RASSF1A promoter methylation is associated with colorectal cancers
16912161 Demonstration of activation in cells derived from two human metastatic melanomas and also in three of seven cutaneous metastatic melanoma tissues.
16891396 Isoenzymes may not be tumor suppressor genes but rather stimulates lung cancer cell proliferation.
16810318 Nuclear commponents Daxx and Ras-association domain family 1C (RASSF1C) link DNA damage to stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) activation in HeLa cells.
16619251 RASSF1A hypermethylation and its inverse correlation with BRAF and/or KRAS mutations in MSI-associated endometrial carcinoma.
16606445 In non-lesional, hepatitic, regenerative & neoplastic liver the RASSF1A gene is increasingly methylated. This is age-related. Early spread of an epigenetically methylated hepatocyte subpopulation may be related to liver tumorigenesis.
16596198 Aberrant methylation of RASSF1A is associated with human non-small cell lung cancer
16510573 RASSF1A facilitates Mst1 activation and thereby promotes apoptosis induced by death receptor signaling.
16344548 RASSF1A is a tumor suppressor that activates Bax via MOAP-1
16329043 Weak to absent protein expression suggests RASSF1 and MLH1 post-transcription deregulation in monophasic synovial sarcoma.
16315018 RASSF1A promoter hypermethylation may be a useful molecular marker for the early detection of ovarian tumors.
16229803 Aberrant hypermethylation of RASSF1A might be an important event in nasopharyngeal carcinoma pathogenesis.
16186793 Aberrant methylation of the RASSF1A promoter region may be of importance in the origin and progression of supratentorial PNET (sPNET) and atypical teratoid/rhabdoid tumors (AT/RT) of childhood.
16140931 Overexpression of RASSF1A diminished the ability of A549 non-small cell lung cancer cells to migrate either through a transwell filter or to close a wound.
16125301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16096369 There is a high frequency of somatic mutations in RSSF1 in nasopharyngeal carcinoma.
16028839 RASSF1A methylation is an early and premalignant alteration in human breast cancer.
16007340 RASSF1C is a binding partner of IGFPB-5 and as a potential mediator of IGFPB-5 effects ERK phosphorylation and cell proliferation.
15987713 RASSF1A promoter methylation is associated with advanced bladder cancer
15980887 results indicate that RASSF1A epigenetic changes are an early event in thyroid tumor pathogenesis and progression
15949439 The tumor suppressor gene RASSF1A is required for death receptor-induced Bax conformational change and apoptosis.
15948711 methylation in tumors; potential involvement of this protein in apoptotic signaling, microtubule stabilization, and cell cycle progression [review]
15942659 Observational study of gene-disease association. (HuGE Navigator)
15942659 a mutant T-allele of RASSF1A at codon 133 is correlated may have a role in development of breast tumors
15870267 data suggest that in epithelial cells, histone inactivation may trigger de novo DNA methylation of the RASSF1A promoter
15867363 RASSF1A exerts a tumor-suppressing effect by blocking oncogene-mediated JNK activation in lung cells.
15867337 Review summarizes current knowledge on genetic, epigenetic, and functional analysis of RASSF1A tumor suppressor gene and its homologues.
15799820 RASSF1A and MGMT promoter regions are hypermethylated and involved in progression of retinoblastoma
15780049 RSSF1A promoter hypermethylation occured at high frequency in patients diagnosed with hepatocellular carcinoma.
15761971 RASSF1A which we have been searching for at 3p21.3 may be one of the key tumor suppressor gene and play an important role in the pathogenesis of extrahepatic cholangiocarcinoma
15736067 Hypermethylation of RASSF1A was commonly observed in primary tumors including lung, breast, pancreas, kidney, liver, cervix, nasopharyngeal, prostate, thyroid and other cancers.
15711568 data suggest that promoter hypermethylation of RASSF1A and resultant alterations of RASSF1A expression may play a critical role in pituitary tumorigenesis
15700308 Epigenetic inactivation of RASSF1A cannot be a prognostic marker of non-small cell lung cancer.
15546880 RABP1 is required for the recruitment of RASSF1A to the spindle poles and for its inhibition of APC-Cdc20 activity during mitosis.
15540210 Smoking under age 18 is an independent risk for RASSF1A hypermethylation, thus identifying a molecular alteration related to the epidemiologic effect of teenage smoking as a lung cancer risk.
15480433 RASSF1A is hypermethylated in early flat-type colorectal tumors
15469871 RASSF1A gene might play an important role in glioma carcinogenesis
15447998 the RASSF1A but not p16INK4a methylated promoter region has a role in progression of non-small cell lung cancer
15378022 RASSF1A may mediate its tumor suppressive effects by inducing growth arrest in the G1 and G2/M phases
15375503 Hypermethylation of the RASSF1A tumor suppressor gene is associated with clear cell renal cell carcinoma
15251938 The tumor suppressor gene, RASSF1A, is an independent prognostic parameter with poor outcome in breast cancer patients.
15205320 Data identify a role for RASSF1A in the regulation of microtubules and cell cycle dynamics that could be part of the mechanism(s) by which RASSF1A exerts its growth inhibition on cancer cells.
15145946 functional association with RASSF1 indicates a role for PMCA4b in the modulation of Ras-mediated signaling
15075335 Data show that the connector enhancer of KSR 1 scaffold protein, through its binding of a RASSF1A/MST1 complex, participates in the proapoptotic signaling initiated by active Ras.
15027117 RASSF1A is a target tumor suppressor from 3p21.3 in nasopharyngeal carcinoma
14961576 Reduced RASSF1A transcript levels are associated with malignant melanomas
14961078 an important role for epigenetic silencing of RASSF1A in the pathogenesis of Hodgkin's lymphoma
14871978 epigenetic inactivation of RASSF1A may have a role in childhood neoplasm initiation
14743218 These findings implicate RASSF1A in the regulation of both APC-Cdc20 activity and mitotic progression.
14729613 Specific inactivation of RASSF1A by short interfering RNA disrupts binding of RASSF1A to p120(E4F) in tumor cells
14688019 Inactivation of RASSF1A by hypermethylation is associated with medulloblastoma pathogenesis
14601057 hypermethylated in invasive and in in situ lobular breast cancer
14511407 there is an inverse relationship between Kras2 activation and RASSF1A promoter methylation in the majority of human lung adenocarcinomas and large cell carcinomas
14506151 RASSF1A promoter methylation has a role in abrogating the same pathway as HPV infection in head and neck tumorigenesis
12912945 epigenetic silencing of RASSF1A may play a role in the development of AC of the uterine cervix
12839968 Hypermethylation of the promoter is associated with age of starting smoking and poor prognosis in NSLC.
12839965 Promoter hypermethylation of this gene is demonstrated in esophageal squamous cell carcinoma.
12795841 There is a significant expression difference among the three RASSF1 transcripts in lung carcinoma. RASSF1A, closely associated with lymph metastasis and TNM stage of lung carcinoma, should be a new tumor suppressor gene.
12794755 RASSF1 is a putative tumor suppressor in non-small cell lung cancer
12792742 Epigenetic inactivation of RASSF1A may play an important role in the tumorigenesis of osteosarcomas
12684417 epigenetic silencing of RASSF1A gene expression by promoter hypermethylation could play an important role in primary esophageal squamous cell carcinogenesis
12673680 Hypermethylation of RASSF1A and Loss of heterozygosity at chromosome 3p21 is associated with cervical cancer
12670917 The RASSF1A gene is turned off in a significant number of melanomas and that CpG promoter region hypermethylation may play a role in the transcriptional inactivation of the RASSF1A gene in malignant melanoma.
12647816 RASSF1A methylation could serve as a useful marker for the prognosis of cancer patients and could become important in early detection of cancer
12594816 Frequent hypermethylation of promoter region of RASSF1A in tumor tissues and voided urine of urinary bladder cancer patients.
12545168 RASSF1A methylation was detected in four of 10 (40%) seminomas and 15 of 18 (83%) nonseminoma TGCT (NSTGCT) components (P=0.0346).These findings are consistent with a model for TGCT pathogenesis in which RASSF1A methylation occurs early in tumorigenesis
12527916 detection of aberrant promoter hypermethylation from smokers, lung cancer, and breast cancer patients
12399230 The high incidence of 3p loss and RASSF1A promoter hypermethylation detected may have implications for this tumor suppressor gene in the malignant progression of cholangiocarcinoma.
12142046 3p loss is common in HNSCC and extensive 3p loss occurs even in early stage tumours. Furthermore, RASSF1A methylation is significantly higher in poorly differentiated then in moderate to well differentiated HNSCC (P=0.0048).
12114441 Epigenetic inactivation of RASSF1A plays an important role in the progression of lung adenocarcinoma.
12082624 Aberrant promoter methylation of RASSF1A may contribute to the pathogenesis of many different forms of pediatric tumors
12082623 RASSFIa protein. There is likely a causal relationship between SV40 infection, progressive RASSF1A methylation and its silencing, and the pathogenesis of mesothelioma.
12082610 promoter methylation studied in 80 patients with head and neck squamous cell carcinoma (HNSCC)
12024041 The RASSF1A tumor suppressor blocks cell cycle progression and inhibits cyclin D1 accumulation (RASSF1A)

AA Sequence

MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTWCDLCGD      1 - 70
FIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIE     71 - 140
QKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYL    141 - 210
PKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSD    211 - 280
KALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG          281 - 344
//

Text Mined References (377)

PMID Year Title
27078152 2016 RASSF1A and DOK1 Promoter Methylation Levels in Hepatocellular Carcinoma, Cirrhotic and Non-Cirrhotic Liver, and Correlation with Liver Cancer in Brazilian Patients.
26759237 2016 RASSF1A Suppresses the Invasion and Metastatic Potential of Human Non-Small Cell Lung Cancer Cells by Inhibiting YAP Activation through the GEF-H1/RhoB Pathway.
26754001 2016 RASSF1 tumor suppressor gene in pancreatic ductal adenocarcinoma: correlation of expression, chromosomal status and epigenetic changes.
26648328 2016 Decreased expression of RASSF1A tumor suppressor gene is associated with worse prognosis in clear cell renal cell carcinoma.
26549256 2015 Alternate RASSF1 Transcripts Control SRC Activity, E-Cadherin Contacts, and YAP-Mediated Invasion.
26482848 2015 Identification of protein arginine N-methyltransferase 5 (PRMT5) as a novel interacting protein with the tumor suppressor protein RASSF1A.
26392358 2015 Methylation biomarkers for pleomorphic lobular breast cancer - a short report.
26370119 2015 Applicability of HIN-1, MGMT and RASSF1A promoter methylation as biomarkers for detecting field cancerization in breast cancer.
26320446 2015 Association between RASSF1A Promoter Hypermethylation and Oncogenic HPV Infection Status in Invasive Cervical Cancer: a Meta-analysis.
26269600 2015 Modulator of apoptosis 1 (MOAP-1) is a tumor suppressor protein linked to the RASSF1A protein.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
26182870 2015 [Meta-analysis of the Association between RASSF1A Gene Promoter Methylation and Non-small Cell Lung Cancer].
26158424 2015 Clinical utility of RASSF1A methylation in human malignancies.
26125908 2015 Expression profile of tumor suppressor gene RASSF1 in lacrimal gland carcinoma.
26112163 2015 Quantitative analysis of mRNA expression levels and DNA methylation profiles of three neighboring genes: FUS1, NPRL2/G21 and RASSF1A in non-small cell lung cancer patients.
26107221 2015 Aberrant Methylation of RASSF1A gene Contribute to the Risk of Renal Cell Carcinoma: a Meta-Analysis.
26073472 2015 Prognostic role of APC and RASSF1A promoter methylation status in cell free circulating DNA of operable gastric cancer patients.
26041820 2015 PML/RAR?-Regulated miR-181a/b Cluster Targets the Tumor Suppressor RASSF1A in Acute Promyelocytic Leukemia.
26019036 DNA methylation markers and serum ?-fetoprotein level are prognostic factors in hepatocellular carcinoma.
25927241 2015 Safeguarding genome stability: RASSF1A tumor suppressor regulates BRCA2 at stalled forks.
25891176 2015 Effects of emodin on the demethylation of tumor-suppressor genes in pancreatic cancer PANC-1 cells.
25886188 2015 Methylation of RASSF1A gene promoter and the correlation with DNMT1 expression that may contribute to esophageal squamous cell carcinoma.
25824751 2015 RASSF1A gene methylation is associated with nasopharyngeal carcinoma risk in Chinese.
25805039 2015 Association of folate and other one-carbon related nutrients with hypermethylation status and expression of RARB, BRCA1, and RASSF1A genes in breast cancer patients.
25703593 2015 Distinct promoter methylation and isoform-specific expression of RASFF1A in placental biopsies from complicated pregnancies.
25556469 2014 Association of RASSF1A promoter methylation with lung cancer risk: a meta-analysis.
25514805 2015 Genome-wide hypomethylation and specific tumor-related gene hypermethylation are associated with esophageal squamous cell carcinoma outcome.
25483734 2015 CpG island promoter hypermethylation of Ras association domain family 1A gene contributes to gastric carcinogenesis.
25368379 2015 The RASSF1A tumor suppressor regulates XPA-mediated DNA repair.
25339045 2014 Association between cigarette smoking and RASSF1A gene promoter hypermethylation in lung cancer patients: a meta- analysis.
25302792 2014 RASSF1A promoter hypermethylation is a strong biomarker of poor survival in patients with salivary adenoid cystic carcinoma in a Chinese population.
25229773 2014 Frequent silencing of RASSF1A via promoter methylation in follicular thyroid hyperplasia: a potential early epigenetic susceptibility event in thyroid carcinogenesis.
25225292 2014 Cell cycle restriction is more important than apoptosis induction for RASSF1A protein tumor suppression.
25218637 2014 RASSF1A-LATS1 signalling stabilizes replication forks by restricting CDK2-mediated phosphorylation of BRCA2.
25152984 Promotor methylation: does it affect response to therapy in chronic hepatitis C (G4) or fibrosis?
25053593 2014 Meta-analyses of methylation markers for prostate cancer.
25040980 2014 Combined effects methylation of FHIT, RASSF1A and RAR? genes on non-small cell lung cancer in the Chinese population.
25038505 2015 Methylated RASSF1A in malignant peripheral nerve sheath tumors identifies neurofibromatosis type 1 patients with inferior prognosis.
25007054 2014 Evidence that RASSF1C stimulation of lung cancer cell proliferation depends on IGFBP-5 and PIWIL1 expression levels.
24998565 2014 Methylation of RASSF1A and CDH13 genes in individualized chemotherapy for patients with non-small cell lung cancer.
24980613 2014 Prognostic value of RASSF1 promoter methylation in prostate cancer.
24935575 2014 Association between Ras association domain family 1A promoter methylation and esophageal squamous cell carcinoma: a meta-analysis.
24870779 2014 Association between RASSF1A Ala133Ser polymorphism and cancer susceptibility: a meta-analysis involving 8,892 subjects.
24756244 2014 Decreased expression of RASSF1A and up-regulation of RASSF1C is associated with esophageal squamous cell carcinoma.
24747657 2014 Clinical validation of an epigenetic assay to predict negative histopathological results in repeat prostate biopsies.
24732797 2014 RASSF1A inactivation unleashes a tumor suppressor/oncogene cascade with context-dependent consequences on cell cycle progression.
24680815 2014 RASSF1A methylation may have two biological roles in neuroblastoma tumorigenesis depending on the ploidy status and age of patients.
24665911 2014 Role of RASSF1A promoter methylation in the pathogenesis of ovarian cancer: a meta-analysis.
24621386 2014 Promoter methylation of the RASSF1A gene may contribute to colorectal cancer susceptibility: a meta-analysis of cohort studies.
24598366 2014 Methylation analysis in spontaneous sputum for lung cancer diagnosis.
24573512 2014 RASSF1A promotes apoptosis and suppresses the proliferation of ovarian cancer cells.
24510557 2014 [Predictive value of placenta-derived RASSF1A sequence expression in maternal plasma for pre-eclampsia].
24505629 2014 Concomitant PIK3CA amplification and RASSF1A or PAX6 hypermethylation predict worse survival in gastric cancer.
24478455 2014 Microtubule segment stabilization by RASSF1A is required for proper microtubule dynamics and Golgi integrity.
24464006 2013 Hypermethylation of selected genes in endometrial carcinogenesis.
24460357 2013 Methylation profile of BRCA1, RASSF1A and ER in Vietnamese women with ovarian cancer.
24383114 2013 Quantitative assessment of RASSF1A methylation as a putative molecular marker in papillary thyroid carcinoma.
24353088 2014 The association between RASSF1A promoter methylation and prostate cancer: evidence from 19 published studies.
24253900 2014 Methylation status and protein expression of RASSF1A in breast cancer patients.
24248815 2014 Intact expression status of RASSF1A in acute myeloid leukemia.
24247422 2014 Upregulation of DNMT1 mediated by HBx suppresses RASSF1A expression independent of DNA methylation.
24197116 2014 Mitotic arrest by tumor suppressor RASSF1A is regulated via CHK1 phosphorylation.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24116157 2013 Association between RASSF1A promoter methylation and ovarian cancer: a meta-analysis.
24073258 2013 Association between RASSF1A promoter methylation and prostate cancer: a systematic review and meta-analysis.
24068440 2013 Promoter hypermethylation of the tumor-suppressor genes RASSF1A, GSTP1 and CDH1 in endometrial cancer.
24001151 2013 Mahanine restores RASSF1A expression by down-regulating DNMT1 and DNMT3B in prostate cancer cells.
23990798 2013 The intronic long noncoding RNA ANRASSF1 recruits PRC2 to the RASSF1A promoter, reducing the expression of RASSF1A and increasing cell proliferation.
23989600 2013 RASSF1A methylation indicates a poor prognosis in hepatoblastoma patients.
23982879 2014 Association of RASSF1A promoter methylation with gastric cancer risk: a meta-analysis.
23979608 2013 GCPII modulates oxidative stress and prostate cancer susceptibility through changes in methylation of RASSF1, BNIP3, GSTP1 and Ec-SOD.
23915220 2013 Epigenetic silencing of RASSF1A deregulates cytoskeleton and promotes malignant behavior of adrenocortical carcinoma.
23902976 2013 Promoter methylation profiles between human lung adenocarcinoma multidrug resistant A549/cisplatin (A549/DDP) cells and its progenitor A549 cells.
23891964 2013 RASSF1A: a potential novel therapeutic target against cardiac hypertrophy.
23891693 2013 Quantitative analysis of RASSF1A promoter methylation in hepatocellular carcinoma and its prognostic implications.
23888343 2013 High-resolution melting-based quantitative analysis of RASSF1 methylation in breast cancer.
23887284 2013 RASSF2 methylation is a strong prognostic marker in younger age patients with Ewing sarcoma.
23886171 2013 Associations between RASSF1A promoter methylation and NSCLC: a meta-analysis of published data.
23865079 2013 Loss of RASSF1A expression in colorectal cancer and its association with K-ras status.
23705663 2013 Polymorphism of A133S and promoter hypermethylation in Ras association domain family 1A gene (RASSF1A) is associated with risk of esophageal and gastric cardia cancers in Chinese population from high incidence area in northern China.
23594797 2013 RASSF1A-mediated regulation of AREG via the Hippo pathway in hepatocellular carcinoma.
23579583 2013 Elevated plasma levels of hypermethylated RASSF1A gene sequences in pregnant women with intrahepatic cholestasis.
23526657 2013 RASSF1A in maternal plasma as a molecular marker of preeclampsia.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23320751 2013 Promoter hypermethylation of the tumor-suppressor genes ITIH5, DKK3, and RASSF1A as novel biomarkers for blood-based breast cancer screening.
23319821 2013 Association of RASSF1A and p63 with poor recurrence-free survival in node-negative stage I-II non-small cell lung cancer.
23192464 2013 BRAF mutation and RASSF1A expression in thyroid carcinoma of southern Italy.
23187089 2013 Association of fetal-derived hypermethylated RASSF1A concentration in placenta-mediated pregnancy complications.
23147544 2012 RASSF1A and ERCC1 expression levels might be predictive of prognosis in advanced, recurrent, and metastatic squamous cell carcinoma of the head and neck treated with docetaxel and cisplatin.
23139773 2012 The association of RAS association domain family Protein1A (RASSF1A) methylation states and bladder cancer risk: a systematic review and meta-analysis.
23128528 2013 DNA methylation of the p14ARF, RASSF1A and APC1A genes as an independent prognostic factor in colorectal cancer patients.
23055343 2012 Aberrant promoter methylation of the RASSF1A and APC genes in epithelial ovarian carcinoma development.
23038753 2013 Methylation of RASSF1A gene promoter is regulated by p53 and DAXX.
23009572 2012 ?-catenin and K-ras mutations and RASSF1A promoter methylation in Taiwanese colorectal cancer patients.
22766745 2013 Loss of heterozygosity and methylation of multiple tumor suppressor genes on chromosome 3 in hepatocellular carcinoma.
22733432 2013 Colorectal cancer and RASSF family--a special emphasis on RASSF1A.
22716213 2012 Galectin-1 is up-regulated by RASSF1A gene in human gastric carcinoma cell line SGC7901.
22695491 2012 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome.
22694820 2012 Correlation between BRAF mutation and promoter methylation of TIMP3, RAR?2 and RASSF1A in thyroid cancer.
22670522 [Alterations of expression level of RASSFIA gene in primary epithelial tumors of various locations].
22615811 2012 The prognostic role of RASSF1A promoter methylation in breast cancer: a meta-analysis of published data.
22591718 2012 RASSF1C modulates the expression of a stem cell renewal gene, PIWIL1.
22581300 2012 Promoter methylation of RASSF1A modulates the effect of the microtubule-targeting agent docetaxel in breast cancer.
22520501 2012 Association of RASSF1A genotype and haplotype with the progression of clear cell renal cell carcinoma in Japanese patients.
22447862 2012 The role of RASSF1A in uveal melanoma.
22446336 2012 Tumorigenic and prognostic significance of RASSF1A expression in low-grade (WHO grade 1 and grade 2) nonmuscle-invasive bladder cancer.
22394463 2012 RASSF1A Ala133Ser polymorphism is associated with increased susceptibility to hepatocellular carcinoma in a Turkish population.
22389451 2012 A RASSF1A polymorphism restricts p53/p73 activation and associates with poor survival and accelerated age of onset of soft tissue sarcoma.
22382007 2012 Ras association domain family 1A: a promising prognostic marker in recurrent nonmuscle invasive bladder cancer.
22332908 2012 Trans-resveratrol alters mammary promoter hypermethylation in women at increased risk for breast cancer.
22315090 2013 Silencing of tumor suppressor genes RASSF1A, SLIT2, and WIF1 by promoter hypermethylation in hereditary breast cancer.
22297548 RASSF1A and CDH1 hypermethylation as potential epimarkers in breast cancer.
22266866 2012 RASSF1A inhibits estrogen receptor alpha expression and estrogen-independent signalling: implications for breast cancer development.
22246327 2012 Promoter methylation of MGMT, MLH1 and RASSF1A tumor suppressor genes in head and neck squamous cell carcinoma: pharmacological genome demethylation reduces proliferation of head and neck squamous carcinoma cells.
22232300 2012 Tissue factor pathway inhibitor-2 may interact with nuclear protein RASSF1C.
22172412 2012 RASSF1A hypermethylation is associated with aflatoxin B1 and polycyclic aromatic hydrocarbon exposure in hepatocellular carcinoma.
22142825 2012 Methylated RASSF1a is the first specific DNA marker for minimal residual disease testing in neuroblastoma.
22139571 2011 Evidence of epigenetic regulation of the tumor suppressor gene cluster flanking RASSF1 in breast cancer cell lines.
21955482 2011 Quantitative detection of RASSF1A DNA promoter methylation in tumors and serum of patients with serous epithelial ovarian cancer.
21910689 2012 Targeted polyubiquitylation of RASSF1C by the Mule and SCF?-TrCP ligases in response to DNA damage.
21884695 2011 Quantitative analysis of multiple methylated genes in plasma for the diagnosis and prognosis of hepatocellular carcinoma.
21873787 2011 [Methylation status of RASSF1A and clinical efficacy of neoadjuvant therapy in patients with advanced epithelial ovarian cancer].
21868547 2011 RASSF1A methylation is predictive of poor prognosis in female breast cancer in a background of overall low methylation frequency.
21838870 2011 Methylation-associated down-regulation of RASSF1A and up-regulation of RASSF1C in pancreatic endocrine tumors.
21822036 2011 Frequent methylation of RASSF1 and RARB in urine sediments from patients with early stage prostate cancer.
21809394 2012 Alterations of RASSF1A in premalignant cervical lesions: clinical and prognostic significance.
21788308 2011 Status of RASSF1A in uveal melanocytes and melanoma cells.
21722812 2011 Hypermethylation-modulated downregulation of RASSF1A expression is associated with the progression of esophageal cancer.
21660959 2011 RASSF1A suppresses melanoma development by modulating apoptosis and cell-cycle progression.
21624251 2011 [DNA methylation and histone modification relate to RASSF1A gene deletion in laryngeal carcinoma tissues].
21489991 2011 Salvador protein is a tumor suppressor effector of RASSF1A with hippo pathway-independent functions.
21473856 2011 RASSF1A suppresses the activated K-Ras-induced oxidative DNA damage.
21473137 2011 [Study of RASSF1A expression and promoter demethylation in Hep-2 cell line].
21468893 2011 The tumor suppressor RASSF1A is a novel effector of small G protein Rap1A.
21450690 2011 Hepatitis C virus core upregulates the methylation status of the RASSF1A promoter through regulation of SMYD3 in hilar cholangiocarcinoma cells.
21364923 2011 Tumor suppressor RASSF1A promoter: p53 binding and methylation.
21338215 2010 RASSF1A promoter hypermethylation as a prognostic marker for hepatocellular carcinoma.
21274674 2011 Promoter hypermethylation of RASSF1A, MGMT, and HIC-1 genes in benign and malignant colorectal tumors.
21221769 2011 Prognostic significance of methylated RASSF1A and PITX2 genes in blood- and bone marrow plasma of breast cancer patients.
21205828 2011 Cullin-4A·DNA damage-binding protein 1 E3 ligase complex targets tumor suppressor RASSF1A for degradation during mitosis.
21199877 2011 The tumor suppressor RASSF1A prevents dephosphorylation of the mammalian STE20-like kinases MST1 and MST2.
21156971 2011 The prognostic value of RASSF1A promoter hypermethylation in non-small cell lung carcinoma: a systematic review and meta-analysis.
21134643 2010 Structural characterization of the DAXX N-terminal helical bundle domain and its complex with Rassf1C.
21115918 2010 DNA content and methylation of p16, DAPK and RASSF1A gene in tumour and distant, normal mucosal tissue of head and neck squamous cell carcinoma patients.
21036752 2010 Dual role of RASSF1 as a tumor suppressor and an oncogene in neuroendocrine tumors of the lung.
20955597 2010 Ras-association domain family 1C protein promotes breast cancer cell migration and attenuates apoptosis.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20877461 2010 Distinct epigenetic domains separated by a CTCF bound insulator between the tandem genes, BLU and RASSF1A.
20864173 2011 Aberrant methylation of tumor suppressor genes in patients with refractory anemia with ring sideroblasts.
20842524 2011 High RASSF1A promoter methylation levels are predictive of poor prognosis in fine-needle aspirate washings of breast cancer lesions.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20800513 Hypermethylation of E-cadherin, p16, p14, and RASSF1A genes in pathologically normal urothelium predict bladder recurrence of bladder cancer after transurethral resection.
20697344 2010 Functional importance of RASSF1A microtubule localization and polymorphisms.
20677556 2010 [Prognostic value of methylation status of RASSF1A gene as an independent factor of non-small cell lung cancer].
20668305 Soy phytoestrogens modify DNA methylation of GSTP1, RASSF1A, EPH2 and BRCA1 promoter in prostate cancer cells.
20562859 2010 Network organization of the human autophagy system.
20535589 2011 Qualitative and quantitative promoter hypermethylation patterns of the P16, TSHR, RASSF1A and RAR?2 genes in papillary thyroid carcinoma.
20505321 2010 Basal-like breast cancer displays distinct patterns of promoter methylation.
20497257 2011 Histone methylation is a critical regulator of the abnormal expression of POU5F1 and RASSF1A in testis cancer cell lines.
20496080 2010 Quantitative assessment of DNA methylation for the detection of cervical neoplasia in liquid-based cytology specimens.
20471512 2010 Epigenetic alterations by methylation of RASSF1A and DAPK1 promoter sequences in mammary carcinoma detected in extracellular tumor DNA.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20361264 2010 RASSF1A polymorphism in familial breast cancer.
20360646 2010 [Value of promoter methylation of RASSF1A, p16, and DAPK genes in induced sputum in diagnosing lung cancers].
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20208994 2010 Frequent promoter hypermethylation of the APC and RASSF1A tumour suppressors in parathyroid tumours.
20193080 2010 Simultaneous down-regulation of tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A in primary non-small cell lung cancer.
20184324 2010 Fluorescent epigenetic small molecule induces expression of the tumor suppressor ras-association domain family 1A and inhibits human prostate xenograft.
20146887 Genetic polymorphisms of MTHFR and aberrant promoter hypermethylation of the RASSF1A gene in bladder cancer risk in a Chinese population.
20140873 2010 [Quantitative detection of the hypermethylated RASSF1A gene in maternal plasma of pre-eclampsia].
20086174 2010 Proapoptotic kinase MST2 coordinates signaling crosstalk between RASSF1A, Raf-1, and Akt.
20079060 2009 [Induced RAS association domain family gene 1A gene expression by arsenic trioxide in nasopharyngeal carcinoma cell].
20075396 2010 MALDI-TOF mass array analysis of RASSF1A and SERPINB5 methylation patterns in human placenta and plasma.
20069457 2010 14-3-3 mediated regulation of the tumor suppressor protein, RASSF1A.
20056647 2010 Gene methylation in breast ductal fluid from BRCA1 and BRCA2 mutation carriers.
20042089 2009 Methylation associated inactivation of RASSF1A and its synergistic effect with activated K-Ras in nasopharyngeal carcinoma.
20038516 2010 Methylation level of the RASSF1A promoter is an independent prognostic factor for clear-cell renal cell carcinoma.
19962312 2009 ATM regulates a RASSF1A-dependent DNA damage response.
19957692 2009 [Methylation status of RASSF1A and DAPK promoter in retinoblastoma].
19940364 2009 Prognostic relevance of promoter hypermethylation of multiple genes in breast cancer patients.
19887622 2009 Aurora B-mediated phosphorylation of RASSF1A maintains proper cytokinesis by recruiting Syntaxin16 to the midzone and midbody.
19854132 2009 Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.
19821102 2009 The association between RASSF1 gene polymorphisms and lung cancer susceptibility among people in Hubei Province of China.
19799084 2009 [Expressions of RASSF1A, Galectin-3 and TPO mRNA in papillary thyroid carcinoma and their clinical significance].
19795445 2010 PTEN, RASSF1 and DAPK site-specific hypermethylation and outcome in surgically treated stage I and II nonsmall cell lung cancer patients.
19761124 2009 Clinicopathological implications of inactivation of RASSF1A in serous epithelial ovarian cancers.
19727727 2010 DNA methylation analysis of tumor suppressor genes in monoclonal gammopathy of undetermined significance.
19657672 2010 Aberrant methylation of RASSF1A is associated with poor survival in Tunisian breast cancer patients.
19652091 2009 Tumor suppressor Ras-association domain family 1 isoform A is a novel regulator of cardiac hypertrophy.
19637319 2009 Aberrant methylation and reduced expression of RASSF1A in Ewing sarcoma.
19578875 2010 Frequent methylation of RASSF1A in synovial sarcoma and the anti-tumor effects of 5-aza-2'-deoxycytidine against synovial sarcoma cell lines.
19548529 [Methylation of promoter region of RASSF1A gene and frequencies of allelic imbalances in chromosome 3 critical regions are correlated with progression of clear cell renal cell carcinoma].
19509163 2009 Methylation of RASSF1A, RASSF2A, and HIN-1 is associated with poor outcome after radiotherapy, but not surgery, in oral squamous cell carcinoma.
19506903 2009 RASSF1A, APC, ESR1, ABCB1 and HOXC9, but not p16INK4A, DAPK1, PTEN and MT1G genes were frequently methylated in the stage I non-small cell lung cancer in China.
19478941 2009 High mutability of the tumor suppressor genes RASSF1 and RBSP3 (CTDSPL) in cancer.
19473831 2009 Frequent hypermethylation of RASSF1A tumour suppressor gene promoter and presence of Merkel cell polyomavirus in small cell lung cancer.
19470737 2009 Hypermethylated genes as biomarkers of cancer in women with pathologic nipple discharge.
19454503 Methylation analysis of BRCA1, RASSF1, GSTP1 and EPHB2 promoters in prostate biopsies according to different degrees of malignancy.
19450668 2009 Regulation of RASSF1A in nasopharyngeal cells and its response to UV irradiation.
19374895 2009 Prognostic significance of RASSF1A promoter methylation in operable breast cancer.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19366060 Methylation of the RASSF1A gene promoter in Uigur women with cervical squamous cell carcinoma.
19326371 2009 Frequent occurrence of RASSF1A promoter hypermethylation and Merkel cell polyomavirus in Merkel cell carcinoma.
19276349 2009 Aurora A regulates prometaphase progression by inhibiting the ability of RASSF1A to suppress APC-Cdc20 activity.
19223555 2009 RASSF1A mediates p21Cip1/Waf1-dependent cell cycle arrest and senescence through modulation of the Raf-MEK-ERK pathway and inhibition of Akt.
19221469 2009 Inactivation of RASSF1A, RARbeta2 and DAP-kinase by promoter methylation correlates with lymph node metastasis in nasopharyngeal carcinoma.
19193434 2009 Methylation status of RASSF1A in patients with chronic myeloid leukemia.
19181545 Increase sensitivity in detecting superficial, low grade bladder cancer by combination analysis of hypermethylation of E-cadherin, p16, p14, RASSF1A genes in urine.
19172108 2009 Study of 5-Aza-CdR on transcription regulation of RASSF1A gene in the BIU87 cell line.
19165202 2009 RASSF1A hypermethylation in pretreatment serum DNA of neuroblastoma patients: a prognostic marker.
19160099 2009 Aberrant CpG island hypermethylation of RASSF1A in gastric cardia adenocarcinoma.
19148529 2009 Promoter methylation of TIMP3 and CDH1 predicts better outcome in head and neck squamous cell carcinoma treated by radiotherapy only.
19145506 2009 [5-Aza-CdR regulates the expression of RASSF1A gene in human gastric cancer cell line and inhibits the growth of cells].
19140316 [Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer].
19118008 2009 NORE1B is a putative tumor suppressor in hepatocarcinogenesis and may act via RASSF1A.
19098985 2008 The growth and tumor suppressors NORE1A and RASSF1A are targets for calpain-mediated proteolysis.
19062280 2008 NDR kinase is activated by RASSF1A/MST1 in response to Fas receptor stimulation and promotes apoptosis.
19024105 2008 Critical role of deltaDNMT3B4/2 in regulating RASSF1A promoter-specific DNA methylation in non-small cell lung cancer.
18824877 2008 Promoter hypermethylation in tumour suppressor genes shows association with stage, grade and invasiveness of bladder cancer.
18822131 2008 RASSF1A protein expression and correlation with clinicopathological parameters in renal cell carcinoma.
18799029 2008 [Inhibitory effect of wild-type RASSF1A gene expression on proliferation of hepatocellular carcinoma QGY-7703 cells].
18788633 2008 [Analysis of RASSF1A promoter hypermethylation in serum DNA of non-small cell lung cancer].
18783461 2008 High frequency of RASSF1A and RARb2 gene promoter methylation in morphologically normal endometrium adjacent to endometrioid adenocarcinoma.
18691570 2008 Methylation of tumor associated genes in tissue and plasma samples from liver disease patients.
18679651 2008 [Methylation of the RASSF1A tumor suppressor gene promoter. Risk factor for carcinogenesis of urological tumors].
18641684 2008 RASSF1A interacts with and activates the mitotic kinase Aurora-A.
18616639 2009 RASSF1A, BLU, NORE1A, PTEN and MGMT expression and promoter methylation in gliomas and glioma cell lines and evidence of deregulated expression of de novo DNMTs.
18608185 2008 Effect of aberrant promoter methylation of FHIT and RASSF1A genes on susceptibility to cervical cancer in a North Indian population.
18592002 2008 RAS signaling in colorectal carcinomas through alteration of RAS, RAF, NF1, and/or RASSF1A.
18566590 2008 The tumour suppressor RASSF1A promotes MDM2 self-ubiquitination by disrupting the MDM2-DAXX-HAUSP complex.
18538349 2008 Clinical significance of promoter hypermethylation of RASSF1A, RARbeta2, BRCA1 and HOXA5 in breast cancers of Indian patients.
18537155 2008 The methylation status of RASSF1A promoter predicts responsiveness to chemotherapy and eventual cure in hepatoblastoma patients.
18514071 2008 The tumour suppressor RASSF1A is a novel substrate of PKC.
18494062 2008 Detection of RASSF1A promoter hypermethylation in serum from gastric and colorectal adenocarcinoma patients.
18483325 2008 DNA methylation in benign breast epithelium in relation to age and breast cancer risk.
18474619 2008 Dynamics of RASSF1A/MOAP-1 association with death receptors.
18469797 2008 Promoter hypermethylation and reduced expression of RASSF1A are frequent molecular alterations of endometrial carcinoma.
18425370 2008 Expression and promoter methylation of the RASSF1A gene in sporadic breast cancers in Chinese women.
18358501 2008 Large-scale analysis of the genetic and epigenetic alterations in hepatocellular carcinoma from Southeast China.
18349282 2008 DNA methylation in tumor and matched normal tissues from non-small cell lung cancer patients.
18347058 2008 The RASSF1A tumor suppressor restrains anaphase-promoting complex/cyclosome activity during the G1/S phase transition to promote cell cycle progression in human epithelial cells.
18337602 2008 DNA methylation markers and early recurrence in stage I lung cancer.
18336597 2008 Hypermethylation of the thrombospondin-1 gene is associated with poor prognosis in penile squamous cell carcinoma.
18330258 2007 [Effects of procaine on human nasopharyngeal carcinoma cell strain CNE-2Z].
18322962 2008 Activator protein-1 involved in growth inhibition by RASSF1A gene in the human gastric carcinoma cell line SGC7901.
18313166 2008 Putative association of the single nucleotide polymorphisms in RASSF1A promoter with Korean lung cancer.
18286482 2008 Combined BubR1 protein down-regulation and RASSF1A hypermethylation in Wilms tumors with diverse cytogenetic changes.
18182852 2007 Hypermethylation of the Ras association domain family 1A (RASSF1A) gene in gallbladder cancer.
18172292 2008 RASSF1A polymorphism A133S is associated with early onset breast cancer in BRCA1/2 mutation carriers.
18086755 2007 Adiposity and age are statistically related to enhanced RASSF1A tumor suppressor gene promoter methylation in normal autopsy kidney tissue.
18071316 2008 Skp2 regulates the antiproliferative function of the tumor suppressor RASSF1A via ubiquitin-mediated degradation at the G1-S transition.
18058812 2008 Quantitative, spatial resolution of the epigenetic field effect in prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17994635 2007 Quantitative aberrations of hypermethylated RASSF1A gene sequences in maternal plasma in pre-eclampsia.
17967182 2007 Identification of a panel of sensitive and specific DNA methylation markers for lung adenocarcinoma.
17960617 2008 Promoter hypermethylation in circulating blood cells identifies prostate cancer progression.
17920725 2008 Gene methylation in pleural mesothelioma: correlations with clinico-pathological features and patient's follow-up.
17899687 2007 RASSF1A promoter is highly methylated in primitive neuroectodermal tumors of the central nervous system.
17889669 2007 RASSF1A elicits apoptosis through an MST2 pathway directing proapoptotic transcription by the p73 tumor suppressor protein.
17720308 2007 Reduced expression of RASSF1A in esophageal and nasopharyngeal carcinomas significantly correlates with tumor stage.
17698033 2007 Mahanine reverses an epigenetically silenced tumor suppressor gene RASSF1A in human prostate cancer cells.
17695396 2007 Malignant transformation-related genes in meningiomas: allelic loss on 1p36 and methylation status of p73 and RASSF1A.
17683489 2008 RASSF1A expression inhibits the growth of hepatocellular carcinoma from Qidong County.
17668224 2007 RASSF1A methylation and cyclin D1 expression in vestibular schwannomas.
17645803 2007 Quantitative promoter methylation analysis of multiple cancer-related genes in renal cell tumors.
17634119 2007 RASSF1A promoter methylation and expression analysis in normal and neoplastic kidney indicates a role in early tumorigenesis.
17608924 2007 Association of diminished expression of RASSF1A with promoter methylation in primary gastric cancer from patients of central China.
17606310 2007 Promoter hypermethylation of RASSF1A and RUNX3 genes as an independent prognostic prediction marker in surgically resected non-small cell lung cancers.
17598981 2007 The tumor suppressor RASSF1A does not interact with Cdc20, an activator of the anaphase-promoting complex.
17563743 2007 Mitotic kinase Aurora-A phosphorylates RASSF1A and modulates RASSF1A-mediated microtubule interaction and M-phase cell cycle regulation.
17538946 2007 Frequent hypermethylation of MST1 and MST2 in soft tissue sarcoma.
17526942 2006 Association of DNA methylation and epigenetic inactivation of RASSF1A and beta-catenin with metastasis in small bowel carcinoid tumors.
17523078 2007 Frequent intra-tumoural heterogeneity of promoter hypermethylation in malignant melanoma.
17477876 2007 Promoter methylation of RASSF1A and DAPK and mutations of K-ras, p53, and EGFR in lung tumors from smokers and never-smokers.
17473182 2007 Epigenetic modifications of RASSF1A gene through chromatin remodeling in prostate cancer.
17444856 2007 Methylation of Ras association domain family protein 1, isoform A correlated with proliferation and drug resistance in hepatocellular carcinoma cell line SMMC-7721.
17379520 2007 RASSF1A is part of a complex similar to the Drosophila Hippo/Salvador/Lats tumor-suppressor network.
17360030 2007 Inverse correlation between RASSF1A hypermethylation, KRAS and BRAF mutations in cervical adenocarcinoma.
17342751 2007 RASSF1A promoter methylation is frequently detected in both pre-malignant and non-malignant microdissected prostatic epithelial tissues.
17320110 2007 Nuclear transport of Ras-associated tumor suppressor proteins: different transport receptor binding specificities for arginine-rich nuclear targeting signals.
17251440 2007 Epigenetic inactivation of RASSF1a in uveal melanoma.
17170014 2007 RASSF1A methylation and K-ras and B-raf mutations and recurrent endometrial cancer.
17099724 2007 Latent membrane protein 1 suppresses RASSF1A expression, disrupts microtubule structures and induces chromosomal aberrations in human epithelial cells.
17064406 2006 Frequent promoter hypermethylation of RASSF1A and CASP8 in neuroblastoma.
16951144 2006 Expression of Delta DNMT3B variants and its association with promoter methylation of p16 and RASSF1A in primary non-small cell lung cancer.
16937357 2007 Promoter hypermethylation of the RASSF1A gene predicts the poor outcome of patients with hepatoblastoma.
16918136 2006 Frequent involvement of ras-signalling pathways in both polypoid-type and flat-type early-stage colorectal cancers.
16912161 2006 Ras-associated protein-1 regulates extracellular signal-regulated kinase activation and migration in melanoma cells: two processes important to melanoma tumorigenesis and metastasis.
16891396 2006 Ras association domain family 1C protein stimulates human lung cancer cell proliferation.
16810318 2006 Release of RASSF1C from the nucleus by Daxx degradation links DNA damage and SAPK/JNK activation.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16619251 2006 RASSF1A hypermethylation and its inverse correlation with BRAF and/or KRAS mutations in MSI-associated endometrial carcinoma.
16606445 2006 Quantitative evaluation of RASSF1A methylation in the non-lesional, regenerative and neoplastic liver.
16596198 2006 Aberrant methylation of RASGRF2 and RASSF1A in human non-small cell lung cancer.
16510573 2006 Role of the tumor suppressor RASSF1A in Mst1-mediated apoptosis.
16344548 2006 The RASSF1A tumor suppressor activates Bax via MOAP-1.
16329043 2006 Molecular alterations of monophasic synovial sarcoma: loss of chromosome 3p does not alter RASSF1 and MLH1 transcriptional activity.
16316825 2005 [The RASSF1 (Ras association domain family protein 1) gene. Category: tumor suppressor gene].
16315018 2006 Aberrant hypermethylation of RASSF1A promoter in ovarian borderline tumors and carcinomas.
16229803 2005 Frequent hypermethylation of RASSF1A and TSLC1, and high viral load of Epstein-Barr Virus DNA in nasopharyngeal carcinoma and matched tumor-adjacent tissues.
16186793 2006 Epigenetic repression of RASSF1A but not CASP8 in supratentorial PNET (sPNET) and atypical teratoid/rhabdoid tumors (AT/RT) of childhood.
16140931 2005 Involvement of the RASSF1A tumor suppressor gene in controlling cell migration.
16125301 2006 Single nucleotide polymorphism at codon 133 of the RASSF1 gene is preferentially associated with human lung adenocarcinoma risk.
16096369 2005 High frequency somatic mutations in RASSF1A in nasopharyngeal carcinoma.
16028839 2005 High frequency of promoter hypermethylation of RASSF1A in tumorous and non-tumourous tissue of breast cancer.
16007340 2005 Ras-association domain family 1 protein, RASSF1C, is an IGFBP-5 binding partner and a potential regulator of osteoblast cell proliferation.
15987713 2006 Carcinogen exposure and gene promoter hypermethylation in bladder cancer.
15980887 2005 RASSF1A and NORE1A methylation and BRAFV600E mutations in thyroid tumors.
15949439 2005 The tumor suppressor RASSF1A and MAP-1 link death receptor signaling to Bax conformational change and cell death.
15948711 2005 Methylation of the tumor suppressor gene RASSF1A in human tumors.
15942659 2005 A polymorphism at codon 133 of the tumor suppressor RASSF1A is associated with tumorous alteration of the breast.
15870267 2005 Chromatin inactivation precedes de novo DNA methylation during the progressive epigenetic silencing of the RASSF1A promoter.
15867363 2005 RASSF1A suppresses the c-Jun-NH2-kinase pathway and inhibits cell cycle progression.
15867337 2005 Role of the Ras-association domain family 1 tumor suppressor gene in human cancers.
15799820 2005 Clinical implications of promoter hypermethylation in RASSF1A and MGMT in retinoblastoma.
15780049 2005 High frequency of promoter hypermethylation of RASSF1A in tumor and plasma of patients with hepatocellular carcinoma.
15761971 2005 Inactivation of RASSF1A, the tumor suppressor gene at 3p21.3 in extrahepatic cholangiocarcinoma.
15753381 2005 Specificity of the methylation-suppressed A isoform of candidate tumor suppressor RASSF1 for microtubule hyperstabilization is determined by cell death inducer C19ORF5.
15736067 2005 The tumor suppressor RASSF1A in human carcinogenesis: an update.
15711568 2005 Inactivation of RASSF1A tumor suppressor gene by aberrant promoter hypermethylation in human pituitary adenomas.
15700308 2005 RASSF1A is not appropriate as an early detection marker or a prognostic marker for non-small cell lung cancer.
15546880 2005 The centrosomal protein RAS association domain family protein 1A (RASSF1A)-binding protein 1 regulates mitotic progression by recruiting RASSF1A to spindle poles.
15540210 2005 Hypermethylation of RASSF1A and BLU tumor suppressor genes in non-small cell lung cancer: implications for tobacco smoking during adolescence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480433 2004 Frequent hypermethylation of RASSF1A in early flat-type colorectal tumors.
15469871 2004 Hypermethylation of the RASSF1A gene in gliomas.
15447998 2004 Value of p16INK4a and RASSF1A promoter hypermethylation in prognosis of patients with resectable non-small cell lung cancer.
15378022 2004 Tumor suppressor RASSF1A is a microtubule-binding protein that stabilizes microtubules and induces G2/M arrest.
15375503 2004 Hypermethylation of the RASSF1A tumor suppressor gene in Japanese clear cell renal cell carcinoma.
15251938 2004 Prognostic DNA methylation marker in serum of cancer patients.
15231747 2004 A protein interaction framework for human mRNA degradation.
15205320 2004 RASSF1A interacts with microtubule-associated proteins and modulates microtubule dynamics.
15145946 2004 Novel functional interaction between the plasma membrane Ca2+ pump 4b and the proapoptotic tumor suppressor Ras-associated factor 1 (RASSF1).
15109305 2004 Regulation of the MST1 kinase by autophosphorylation, by the growth inhibitory proteins, RASSF1 and NORE1, and by Ras.
15075335 2004 The scaffold protein CNK1 interacts with the tumor suppressor RASSF1A and augments RASSF1A-induced cell death.
15027117 2004 RASSF1A is a target tumor suppressor from 3p21.3 in nasopharyngeal carcinoma.
14961576 2004 Frequent alterations of Ras signaling pathway genes in sporadic malignant melanomas.
14961078 2004 Frequent epigenetic inactivation of the RASSF1A tumor suppressor gene in Hodgkin's lymphoma.
14871978 2004 Ubiquitous aberrant RASSF1A promoter methylation in childhood neoplasia.
14743218 2004 The tumour suppressor RASSF1A regulates mitosis by inhibiting the APC-Cdc20 complex.
14729613 2004 Identification of the E1A-regulated transcription factor p120 E4F as an interacting partner of the RASSF1A candidate tumor suppressor gene.
14688019 2004 Identification of tumour-specific epigenetic events in medulloblastoma development by hypermethylation profiling.
14603253 2003 Control of microtubule stability by the RASSF1A tumor suppressor.
14601057 2003 DNA methylation of RASSF1A, HIN-1, RAR-beta, Cyclin D2 and Twist in in situ and invasive lobular breast carcinoma.
14511407 RASSF1A promoter methylation and Kras2 mutations in non small cell lung cancer.
14506151 2003 Epigenetic inactivation of RASSF1A in head and neck cancer.
12912945 2003 The RASSF1A tumor suppressor gene is commonly inactivated in adenocarcinoma of the uterine cervix.
12839968 2003 Hypermethylation of RASSF1A promoter is associated with the age at starting smoking and a poor prognosis in primary non-small cell lung cancer.
12839965 2003 Allele loss and promoter hypermethylation of VHL, RAR-beta, RASSF1A, and FHIT tumor suppressor genes on chromosome 3p in esophageal squamous cell carcinoma.
12795841 2003 [Expression of different RASSF1 transcripts and its clinical significance in lung carcinoma].
12794755 2003 RASSF1A gene inactivation in non-small cell lung cancer and its clinical implication.
12792742 Inactivation of the RASSF1A in osteosarcoma.
12762840 Novel complex integrating mitochondria and the microtubular cytoskeleton with chromosome remodeling and tumor suppressor RASSF1 deduced by in silico homology analysis, interaction cloning in yeast, and colocalization in cultured cells.
12684417 2003 Promoter hypermethylation of RASSF1A in esophageal squamous cell carcinoma.
12673680 2003 Hypermethylation of the tumor suppressor gene RASSFIA and frequent concomitant loss of heterozygosity at 3p21 in cervical cancers.
12670917 2003 Epigenetic inactivation of RAS association domain family protein 1 (RASSF1A) in malignant cutaneous melanoma.
12647816 2003 Epigenetic inactivation of the Ras-association domain family 1 (RASSF1A) gene and its function in human carcinogenesis.
12594816 2003 Frequent hypermethylation of promoter region of RASSF1A in tumor tissues and voided urine of urinary bladder cancer patients.
12545168 2003 Frequent epigenetic inactivation of the RASSF1A tumour suppressor gene in testicular tumours and distinct methylation profiles of seminoma and nonseminoma testicular germ cell tumours.
12527916 2003 Detection of RASSF1A aberrant promoter hypermethylation in sputum from chronic smokers and ductal carcinoma in situ from breast cancer patients.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399230 2002 Frequent loss of chromosome 3p and hypermethylation of RASSF1A in cholangiocarcinoma.
12142046 2002 Frequent 3p allele loss and epigenetic inactivation of the RASSF1A tumour suppressor gene from region 3p21.3 in head and neck squamous cell carcinoma.
12114441 2002 Clinicopathological significance of epigenetic inactivation of RASSF1A at 3p21.3 in stage I lung adenocarcinoma.
12082624 2002 Aberrant promoter methylation and silencing of the RASSF1A gene in pediatric tumors and cell lines.
12082623 2002 Progressive aberrant methylation of the RASSF1A gene in simian virus 40 infected human mesothelial cells.
12082610 2002 Patterns of gene promoter methylation in squamous cell cancer of the head and neck.
12067994 2002 The RASSF1A tumor suppressor gene is inactivated in prostate tumors and suppresses growth of prostate carcinoma cells.
12032847 2002 K-ras mutations and RASSF1A promoter methylation in colorectal cancer.
12024041 2002 The RASSF1A tumor suppressor blocks cell cycle progression and inhibits cyclin D1 accumulation.
11857081 2002 The putative tumor suppressor RASSF1A homodimerizes and heterodimerizes with the Ras-GTP binding protein Nore1.
11390984 2001 The candidate tumor suppressor gene, RASSF1A, from human chromosome 3p21.3 is involved in kidney tumorigenesis.
11333291 2001 Epigenetic inactivation of RASSF1A in lung and breast cancers and malignant phenotype suppression.
11306494 2001 Hypermethylation of the cpG island of Ras association domain family 1A (RASSF1A), a putative tumor suppressor gene from the 3p21.3 locus, occurs in a large percentage of human breast cancers.
11085536 2000 The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 Tumor Suppressor Gene Consortium.
10998413 2000 Ras uses the novel tumor suppressor RASSF1 as an effector to mediate apoptosis.
10888881 2000 Epigenetic inactivation of a RAS association domain family protein from the lung tumour suppressor locus 3p21.3.