Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.73
PubTator Score 107.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-05
atypical teratoid/rhabdoid tumor -1.200 1.4e-05
breast carcinoma -1.700 1.1e-05
ductal carcinoma in situ -1.100 6.7e-04
ependymoma -1.100 3.8e-07
facioscapulohumeral dystrophy 1.900 5.7e-03
group 4 medulloblastoma -1.700 1.3e-07
inflammatory breast cancer -1.100 1.4e-02
intraductal papillary-mucinous carcinoma... -1.100 6.6e-04
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-03
invasive ductal carcinoma -1.800 2.5e-04
lung adenocarcinoma -2.900 1.3e-16
lung cancer -2.900 8.5e-06
nephrosclerosis 1.142 2.4e-04
non-small cell lung cancer -2.225 3.2e-22
ovarian cancer 1.100 2.5e-03
primitive neuroectodermal tumor -1.300 5.6e-04

Gene RIF (6)

AA Sequence

MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPLPPPPPHVELR      1 - 70
RVGAVKAAGGASGSRAKRISQLFRGSGTGTTGSSGAGGPGTPGGAQRWASEKKLPELAAGVAPEPPLATR     71 - 140
ATAPPGVLKIFGAGLASGANYKSVLATARSTARELVAEALERYGLAGSPGGGPGESSCVDAFALCDALGR    141 - 210
PAAAGVGSGEWRAEHLRVLGDSERPLLVQELWRARPGWARRFELRGREEARRLEQEAFGAADSEGTGAPS    211 - 280
WRPQKNRSRAASGGAALASPGPGTGSGAPAGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMA    281 - 350
PGAADAQIGTADPGDFDQLTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGNSSGRGGSP    351 - 420
APYVDTFLNAPDILPRHCTVRAGPEHPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFMYKDP    421 - 490
RTGGSGPARPPWLPARPGATPPGPGWAFSCRLCGRGLQERGEALAAYLDGREPVLRFRPREEEALLGEIV    491 - 560
RAAAAGSGDLPPLGPATLLALCVQHSARELELGHLPRLLGRLARLIKEAVWEKIKEIGDRQPENHPEGVP    561 - 630
EVPLTPEAVSVELRPLMLWMANTTELLSFVQEKVLEMEKEADQEDPQLCNDLELCDEAMALLDEVIMCTF    631 - 700
QQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRPTLGVFQAALELTSQCELHPDLVSQ    701 - 770
TFGYLFFFSNASLLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGLGDIATEFFRKLSMAVNLLC    771 - 840
VPRTSLLKASWSSLRTDHPTLTPAQLHHLLSHYQLGPGRGPPAAWDPPPAEREAVDTGDIFESFSSHPPL    841 - 910
ILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELPANYRHGPPVATSP                     911 - 963
//

Text Mined References (16)

PMID Year Title