Property Summary

NCBI Gene PubMed Count 29
PubMed Score 32.96
PubTator Score 24.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.517 5.0e-03
tuberculosis -1.200 2.7e-05
lung cancer -1.900 2.3e-04
sarcoidosis 1.100 1.1e-02
interstitial cystitis 1.900 8.9e-04
invasive ductal carcinoma 2.207 8.9e-05
progressive supranuclear palsy -1.100 2.1e-02
ulcerative colitis 1.400 8.6e-04
ovarian cancer 1.300 1.1e-08

Gene RIF (12)

PMID Text
24779681 Ras activator RasGRP3 may have a role in the pathological behavior of breast cancer cells and may constitute a therapeutic target for human breast cancer.
24418912 Knockdown of RasGRP3 inhibited proliferation in prostate neoplasms.
21602881 The identification of the role of RasGRP3 in melanoma highlights its importance, as a Ras activator, in the phosphoinositide signaling pathway in human melanoma.
20876802 RasGRP3 contributes to the malignant phenotype of prostate cancer cells and may constitute a novel therapeutic target for human prostate cancer.
20516000 Significant associations were found for the single nucleotide polymorphism rs13385731 of RasGRP3 with malar rash, discoid rash, and antinuclear antibody in patients with systemic lupus erythematosus
20516000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19421330 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17012239 dynein light chain 1 represents a novel anchoring protein for RasGRP3 that may regulate subcellular localization of the exchange factor
15657177 studies support the hypothesis that RasGRP phosphorylation by PKC is a mechanism that integrates DAG signaling systems in T and B cells
15572660 A vascular gene trap screen defines RASGRP3 as an angiogenesis-regulated gene required for the endothelial response to phorbol esters.

AA Sequence

MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEF      1 - 70
RLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSK     71 - 140
KGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVL    141 - 210
SKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSS    211 - 280
NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL    281 - 350
EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH    351 - 420
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMG    421 - 490
PGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSL    491 - 560
PGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGS    561 - 630
HTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG              631 - 690
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24779681 2014 Function of RasGRP3 in the formation and progression of human breast cancer.
24418912 2014 Upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
21602881 2011 RasGRP3, a Ras activator, contributes to signaling and the tumorigenic phenotype in human melanoma.
20876802 2010 RasGRP3 contributes to formation and maintenance of the prostate cancer phenotype.
20516000 2010 TNIP1, SLC15A4, ETS1, RasGRP3 and IKZF1 are associated with clinical features of systemic lupus erythematosus in a Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19421330 2009 Genome-wide association study of young-onset hypertension in the Han Chinese population of Taiwan.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17012239 2006 The exchange factor and diacylglycerol receptor RasGRP3 interacts with dynein light chain 1 through its C-terminal domain.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15657177 2005 Phosphorylation of RasGRP3 on threonine 133 provides a mechanistic link between PKC and Ras signaling systems in B cells.
15572660 2004 A vascular gene trap screen defines RasGRP3 as an angiogenesis-regulated gene required for the endothelial response to phorbol esters.
15545601 2004 Activation of RasGRP3 by phosphorylation of Thr-133 is required for B cell receptor-mediated Ras activation.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15213298 2004 PKCdelta associates with and is involved in the phosphorylation of RasGRP3 in response to phorbol esters.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12730099 2003 Integration of DAG signaling systems mediated by PKC-dependent phosphorylation of RasGRP3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11221888 2001 Phorbol esters modulate the Ras exchange factor RasGRP3.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10934204 2000 Identification of guanine nucleotide exchange factors (GEFs) for the Rap1 GTPase. Regulation of MR-GEF by M-Ras-GTP interaction.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.