Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.55
PubTator Score 18.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 3.800 1.1e-07
cutaneous lupus erythematosus 1.300 4.8e-03
osteosarcoma -4.080 4.7e-08
cystic fibrosis -1.264 1.6e-04
atypical teratoid / rhabdoid tumor -1.300 2.6e-06
medulloblastoma, large-cell -1.600 1.8e-04
adrenocortical carcinoma -1.177 7.6e-06
non-small cell lung cancer -1.566 1.4e-26
interstitial cystitis 1.800 1.8e-03
lung adenocarcinoma -1.700 1.0e-07

Protein-protein Interaction (5)

Gene RIF (6)

PMID Text
24958846 Human CalDAG-GEFI gene (RASGRP2) mutation affects platelet function and causes severe bleeding.
23611601 phosphorylation of CalDAG-GEFI is a critical mechanism by which PKA controls Rap1b-dependent platelet aggregation
23563504 RasGRP2 increases cell viability and cell-matrix adhesion through increased Ras expression and Rap1 activation, respectively, in endothelial cells.
23530823 NIH3T3 cells were found nonpermissive to mtHSV but they became permissive following transformation with the Rasgrp2 gene. This effect was linked to the activation of the Ras-PKR signaling pathway.
20606303 analyzed the 5'-flanking region of rasgrp2 gene by a luciferase assay, which revealed that not only a promoter but also silencer regions were present upstream of D1E, suggesting rasgrp2 expression is controlled by a combination of promotion and repression
12239348 CalDAG-GEFI plays a role in inside-out signaling to alphaIIbbeta3

AA Sequence

MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS      1 - 70
LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG     71 - 140
QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM    141 - 210
ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV    211 - 280
TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL    281 - 350
RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ    351 - 420
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV    421 - 490
LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS    491 - 560
APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL                         561 - 609
//

Text Mined References (28)

PMID Year Title
24958846 2014 Human CalDAG-GEFI gene (RASGRP2) mutation affects platelet function and causes severe bleeding.
23908768 2013 Structural analysis of autoinhibition in the Ras-specific exchange factor RasGRP1.
23611601 2013 Phosphorylation of CalDAG-GEFI by protein kinase A prevents Rap1b activation.
23563504 Ras guanyl nucleotide releasing protein 2 affects cell viability and cell-matrix adhesion in ECV304 endothelial cells.
23530823 2013 Rasgrp2 regulates the permissiveness of NIH3T3 cells to a herpes simplex virus 1 mutant with inactivated ICP34.5 gene.
21768215 2011 Genome-wide association study for serum urate concentrations and gout among African Americans identifies genomic risk loci and a novel URAT1 loss-of-function allele.
20606303 2010 Identification of the gene regulatory region in human rasgrp2 gene in vascular endothelial cells.
19234463 2009 Leukocyte adhesion deficiency-III is caused by mutations in KINDLIN3 affecting integrin activation.
19234460 2009 A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans.
19064721 2009 LAD-1/variant syndrome is caused by mutations in FERMT3.
17702895 2007 Essential role for Rap1 GTPase and its guanine exchange factor CalDAG-GEFI in LFA-1 but not VLA-4 integrin mediated human T-cell adhesion.
17576779 2007 A LAD-III syndrome is associated with defective expression of the Rap-1 activator CalDAG-GEFI in lymphocytes, neutrophils, and platelets.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16076873 2005 Multiple roles of Rap1 in hematopoietic cells: complementary versus antagonistic functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334074 2004 CalDAG-GEFI integrates signaling for platelet aggregation and thrombus formation.
14988412 2004 F-actin-dependent translocation of the Rap1 GDP/GTP exchange factor RasGRP2.
14702343 2004 Rap1-mediated lymphocyte function-associated antigen-1 activation by the T cell antigen receptor is dependent on phospholipase C-gamma1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239348 2002 Megakaryocytes derived from embryonic stem cells implicate CalDAG-GEFI in integrin signaling.
11503142 2001 Guanine nucleotide exchange factors CalDAG-GEFI and CalDAG-GEFII are colocalized in striatal projection neurons.
11292831 2001 A CalDAG-GEFI/Rap1/B-Raf cassette couples M(1) muscarinic acetylcholine receptors to the activation of ERK1/2.
11278453 2001 Activation of the Rap1 guanine nucleotide exchange gene, CalDAG-GEF I, in BXH-2 murine myeloid leukemia.
10918068 2000 Characterization of RasGRP2, a plasma membrane-targeted, dual specificity Ras/Rap exchange factor.
9789079 1998 A Rap guanine nucleotide exchange factor enriched highly in the basal ganglia.
9341881 1997 The germinal center kinase gene and a novel CDC25-like gene are located in the vicinity of the PYGM gene on 11q13.