Property Summary

Ligand Count 5
NCBI Gene PubMed Count 46
PubMed Score 105.60
PubTator Score 59.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.900 8.8e-03
astrocytic glioma -1.400 1.6e-02
Astrocytoma, Pilocytic -3.800 5.4e-08
Atopic dermatitis 1.100 7.5e-04
atypical teratoid / rhabdoid tumor -3.900 1.3e-06
cystic fibrosis -3.954 5.1e-07
Down syndrome -1.200 2.2e-03
ependymoma -3.600 3.6e-12
glioblastoma -2.400 1.7e-05
group 4 medulloblastoma -4.900 1.8e-06
interstitial cystitis 2.200 1.2e-03
invasive ductal carcinoma 1.357 1.0e-02
lung cancer -1.300 7.0e-03
lung carcinoma -1.600 4.2e-07
malignant mesothelioma -1.300 1.7e-02
medulloblastoma, large-cell -5.600 4.7e-07
oligodendroglioma -1.400 5.5e-07
osteosarcoma -3.857 4.5e-05
ovarian cancer -1.300 8.4e-03
primary Sjogren syndrome 2.300 2.4e-04
primitive neuroectodermal tumor -2.500 6.8e-03
psoriasis 1.400 4.8e-09
sarcoidosis 1.700 4.6e-02
ulcerative colitis 2.600 1.3e-06

Gene RIF (29)

AA Sequence

MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCI      1 - 70
QSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMF     71 - 140
KMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELS    141 - 210
EHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQ    211 - 280
VAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDF    281 - 350
KIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY    351 - 420
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYI    421 - 490
SQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAG    491 - 560
FLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGP    561 - 630
FTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQ    631 - 700
DTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLK    701 - 770
YAQKKIESLQLEKSNHVLAQMEQGDCS                                               771 - 797
//

Text Mined References (53)

PMID Year Title