Property Summary

NCBI Gene PubMed Count 28
PubMed Score 22.39
PubTator Score 16.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -3.500 1.4e-03
ependymoma -3.400 9.7e-03
oligodendroglioma -2.900 7.2e-03
glioblastoma -4.200 1.7e-06
osteosarcoma -1.624 8.6e-03
medulloblastoma -3.100 1.1e-03
atypical teratoid / rhabdoid tumor -3.700 1.6e-06
medulloblastoma, large-cell -2.900 1.7e-02
primitive neuroectodermal tumor -3.600 5.1e-04
tuberculosis and treatment for 3 months 1.900 2.5e-06
intraductal papillary-mucinous adenoma (... -1.300 1.4e-02
pediatric high grade glioma -3.400 5.2e-06
pilocytic astrocytoma -2.900 3.9e-05
Breast cancer 2.300 3.0e-03
Pick disease -2.000 2.1e-03
ductal carcinoma in situ -1.600 5.1e-03
invasive ductal carcinoma -1.800 8.6e-03
ovarian cancer 1.200 4.3e-02
pituitary cancer 1.300 2.7e-02
sarcoidosis -1.100 6.2e-03

Gene RIF (10)

PMID Text
24692549 these results suggest that betaarrestin1 regulates rasgrf2 gene expression and Rac activation to affect membrane protrusion and cell migration and invasion.
23827383 Case-control studies reveal malignant mesothelioma risk associated with variants in the SDK1, CRTAM and RASGRF2 genes.
23223532 RASGRF2 has a role in the regulation of mesolimbic dopamine neuron activity, reward response, and alcohol use and abuse
21685891 Demonstrate a role for RasGRF1/2 as negative regulators of Cdc42 activation, suppressing tumor cell movement, cytoskeletal dynamics and cell transformation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20011522 These data reveal unexpected negative roles for Vav1 and RasGRF2 in different stages of T-cell lymphoma progression.
19692568 Farnesylated but not geranylgeranylated TC21 can be activated by RasGRF2 due to its pleckstrin homology 1 domain, by a mechanism independent of localization & of its ability to associate to membranes.
17923690 These results identify RasGRF2 as an additional component of the signaling machinery involved in T-cell receptor- and NF-AT-mediated immune responses.
16596198 Aberrant methylation of RASGRF2 is associated with human non-small cell lung cancer
14749369 RasGRF family exchange factors, both endogenous and ectopically expressed, are present in the endoplasmic reticulum but not in the Golgi complex

AA Sequence

MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLLEG      1 - 70
CSCERTPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIER     71 - 140
EVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIK    141 - 210
KVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSK    211 - 280
KPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVL    281 - 350
ANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE    351 - 420
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKE    421 - 490
GERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDSKGSGQVFGHLDFKIVVEPPD    491 - 560
AAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKT    561 - 630
LNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLEL    631 - 700
FFATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTT    701 - 770
QSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP    771 - 840
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFII    841 - 910
RRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKAAANILRALSQDDQDDIH    911 - 980
LKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHF    981 - 1050
NDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTK   1051 - 1120
ALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIR   1121 - 1190
EIRQFQQTSYRIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPRLPA                          1191 - 1237
//

Text Mined References (33)

PMID Year Title
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
24692549 2014 ?Arrestin1 regulates the guanine nucleotide exchange factor RasGRF2 expression and the small GTPase Rac-mediated formation of membrane protrusion and cell motility.
23827383 2013 A genome-wide association study for malignant mesothelioma risk.
23568457 2013 Genetic variants associated with disordered eating.
23223532 2012 RASGRF2 regulates alcohol-induced reinforcement by influencing mesolimbic dopamine neuron activity and dopamine release.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
21685891 2011 RasGRF suppresses Cdc42-mediated tumour cell movement, cytoskeletal dynamics and transformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21130132 2011 Genome-wide association study of blood pressure response to methylphenidate treatment of attention-deficit/hyperactivity disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20011522 2009 The use of knockout mice reveals a synergistic role of the Vav1 and Rasgrf2 gene deficiencies in lymphomagenesis and metastasis.
19692568 2009 Structural and spatial determinants regulating TC21 activation by RasGRF family nucleotide exchange factors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17923690 2007 RasGRF2, a guanosine nucleotide exchange factor for Ras GTPases, participates in T-cell signaling responses.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16596198 2006 Aberrant methylation of RASGRF2 and RASSF1A in human non-small cell lung cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128856 2004 p35/cyclin-dependent kinase 5 phosphorylation of ras guanine nucleotide releasing factor 2 (RasGRF2) mediates Rac-dependent Extracellular Signal-regulated kinase 1/2 activity, altering RasGRF2 and microtubule-associated protein 1b distribution in neurons.
14749369 2004 Activation of H-Ras in the endoplasmic reticulum by the RasGRF family guanine nucleotide exchange factors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622581 2003 The NMDA receptor is coupled to the ERK pathway by a direct interaction between NR2B and RasGRF1.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12176907 2002 Inhibitory effects of a dominant-interfering form of the Rho-GTPase Cdc42 in the chemoattractant-elicited signaling pathways leading to NADPH oxidase activation in differentiated HL-60 cells.
11856323 2002 Dematin interacts with the Ras-guanine nucleotide exchange factor Ras-GRF2 and modulates mitogen-activated protein kinase pathways.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
10373510 1999 Ras-specific exchange factor GRF: oligomerization through its Dbl homology domain and calcium-dependent activation of Raf.
9707409 1998 The exchange factor Ras-GRF2 activates Ras-dependent and Rac-dependent mitogen-activated protein kinase pathways.
9032266 1997 Cloning and characterization of Ras-GRF2, a novel guanine nucleotide exchange factor for Ras.
9027497 1997 Mapping of the Ras-GRF2 gene (GRF2) to mouse chromosome 13C3-D1 and human chromosome 5q13, near the Ras-GAP gene.