Property Summary

NCBI Gene PubMed Count 30
PubMed Score 23.68
PubTator Score 16.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -3.100 1.7e-03
astrocytic glioma -3.500 1.4e-03
Astrocytoma, Pilocytic -2.900 3.5e-05
atypical teratoid / rhabdoid tumor -3.700 1.6e-06
Breast cancer 1.100 4.8e-03
ductal carcinoma in situ -1.600 5.1e-03
ependymoma -1.100 7.1e-03
glioblastoma -2.900 2.9e-07
group 4 medulloblastoma -2.800 4.7e-03
intraductal papillary-mucinous adenoma (... -1.300 1.4e-02
invasive ductal carcinoma -1.800 8.6e-03
medulloblastoma, large-cell -2.900 1.7e-02
oligodendroglioma -1.200 2.1e-03
osteosarcoma -1.624 8.6e-03
ovarian cancer -1.100 1.1e-03
Pick disease -2.000 2.1e-03
pituitary cancer 1.300 2.7e-02
primitive neuroectodermal tumor -1.400 3.6e-03
sarcoidosis -1.100 6.2e-03
tuberculosis 1.700 2.8e-05

Gene RIF (12)

AA Sequence

MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLLEG      1 - 70
CSCERTPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIER     71 - 140
EVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIK    141 - 210
KVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSK    211 - 280
KPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVL    281 - 350
ANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE    351 - 420
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKE    421 - 490
GERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDSKGSGQVFGHLDFKIVVEPPD    491 - 560
AAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKT    561 - 630
LNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLEL    631 - 700
FFATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTT    701 - 770
QSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP    771 - 840
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFII    841 - 910
RRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKAAANILRALSQDDQDDIH    911 - 980
LKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHF    981 - 1050
NDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTK   1051 - 1120
ALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIR   1121 - 1190
EIRQFQQTSYRIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPRLPA                          1191 - 1237
//

Text Mined References (35)

PMID Year Title