Property Summary

NCBI Gene PubMed Count 39
PubMed Score 92.38
PubTator Score 94.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
interstitial lung disease 1.600 7.1e-03
chronic lymphocytic leukemia 1.134 4.0e-03
malignant mesothelioma 4.200 1.4e-08
astrocytoma -1.300 1.8e-16
glioblastoma -2.000 3.8e-11
oligodendroglioma -1.300 3.4e-10
ependymoma -2.000 5.2e-14
group 3 medulloblastoma -2.600 2.0e-05
atypical teratoid/rhabdoid tumor -2.400 3.1e-11
medulloblastoma, large-cell -1.800 3.3e-05
primitive neuroectodermal tumor -2.200 1.1e-05
non-small cell lung cancer -2.206 2.6e-27
lung cancer -3.300 3.7e-06
pediatric high grade glioma -2.100 8.9e-09
pilocytic astrocytoma -2.400 3.4e-10
Pick disease -2.000 1.6e-03

Protein-protein Interaction (4)

Gene RIF (20)

PMID Text
26644762 Carriers of the rs8027411 G allele in the RASGRF1 gene may be at a lower risk of high myopia in Chinese and Japanese populations. (Meta-analysis)
26521038 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
25267792 CARD9 regulates H-Ras activation by linking Ras-GRF1 to H-Ras, which mediates Dectin-1-induced extracellular signal-regulated protein kinase (ERK) activation and proinflammatory responses when stimulated by their ligands.
24597981 Rasgrf-1 is a novel GEF protein that has a role in BCR signaling and its overexpression further activates the Ras/Erk/MAPK pathway in CLL specimens.
24150758 ZIC2 and RASGRF1 are susceptibility genes, not only for common myopia, but also for high myopia.
23834555 In this study, there was no association of the analyzed SNPs located in RASGRF1. GJD2, and ACTC1 with pathological myopia.
23200899 Decreased expression of Ras-GRF1 could be involved in the pathogenesis of human temporal lobe epilepsy.
22961779 Aberrant methylation of RASGRF1 is associated with an epigenetic field defect and increased risk of gastric cancer.
22752028 RasGRF1 plays an important role in alveolar rhabdomyosarcoma pathogenesis
21685891 Demonstrate a role for RasGRF1/2 as negative regulators of Cdc42 activation, suppressing tumor cell movement, cytoskeletal dynamics and cell transformation.
20835236 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20835236 Single Nucleotide Polymorphisms in RASGRF1 is associated with refractive errors and myopia.
19692568 Farnesylated or geranylgeranylated TC21 can be activated by RasGRF1 due to its pleckstrin homology 1 domain, by a mechanism independent of localization & of its ability to associate to membranes.
19678938 Enhanced expression and post-translational modification of RasGRF1 contributes to MMP-3 production in RA
17611684 zoledronate induces DNA damage and S phase arrest, accompanied by activation of the ATM/Chk1/cdc25 pathway in a human osteosarcoma cell line
17030618 Rasgrf1 transgenic repeats serve at least two functions: first, to establish Rasgrf1 DNA methylation in the male germ line, and second, to resist global demethylation in the preimplantation embryo.
16969075 Vitamin K3 inhibitor H32 differentially inhibited growth of normal and liver tumor cells by preferentially inhibiting the actions of Cdc25 phosphatases
16855028 Taken together our results demonstrate that U2AF35a is essential for HeLa cell division and suggest a novel role for both U2AF35 protein isoforms as regulators of alternative splicing of a specific subset of genes.
14749369 RasGRF family exchange factors, both endogenous and ectopically expressed, are present in the endoplasmic reticulum but not in the Golgi complex
12775420 Downregulation of guanine nucleotide-releasing protein, CD151/PETA-3, neuronatin, neuroendocrine differentiation factor, mitochondria 16s rRNA, and signal recognition particle is observed in HIV-1 infected and HIV-1 gp120-treated astrocytes

AA Sequence

MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEG      1 - 70
CVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALM     71 - 140
QKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPNDEDSDIKKIKKVQ    141 - 210
SFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPP    211 - 280
ITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHC    281 - 350
KQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS    351 - 420
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLKKEGER    421 - 490
QCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPF    491 - 560
TVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCD    561 - 630
DVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPIS    631 - 700
AIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKAL    701 - 770
DLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE    771 - 840
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIAT    841 - 910
AGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVI    911 - 980
GFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLD    981 - 1050
HLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADIC   1051 - 1120
RCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYL   1121 - 1190
GMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL   1191 - 1260
YESSLRIEPKLPT                                                            1261 - 1273
//

Text Mined References (41)

PMID Year Title
26644762 2015 Polymorphism in the RASGRF1 gene with high myopia: A meta-analysis.
26521038 2016 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
25267792 2014 CARD9 mediates Dectin-1-induced ERK activation by linking Ras-GRF1 to H-Ras for antifungal immunity.
24597981 2014 Amplification of B cell receptor-Erk signaling by Rasgrf-1 overexpression in chronic lymphocytic leukemia.
24150758 2013 Association between ZIC2, RASGRF1, and SHISA6 genes and high myopia in Japanese subjects.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23834555 2015 Evaluating the association between pathological myopia and SNPs in RASGRF1. ACTC1 and GJD2 genes at chromosome 15q14 and 15q25 in a Chinese population.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23200899 2013 Decreased expression of Ras-GRF1 in the brain tissue of the intractable epilepsy patients and experimental rats.
22961779 2012 Aberrant methylation of RASGRF1 is associated with an epigenetic field defect and increased risk of gastric cancer.
22752028 2012 RasGRF1 regulates proliferation and metastatic behavior of human alveolar rhabdomyosarcomas.
21685891 2011 RasGRF suppresses Cdc42-mediated tumour cell movement, cytoskeletal dynamics and transformation.
20835236 2010 A genome-wide association study for myopia and refractive error identifies a susceptibility locus at 15q25.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19692568 2009 Structural and spatial determinants regulating TC21 activation by RasGRF family nucleotide exchange factors.
19678938 2009 The Ras guanine nucleotide exchange factor RasGRF1 promotes matrix metalloproteinase-3 production in rheumatoid arthritis synovial tissue.
17611684 2007 Zoledronate-induced S phase arrest and apoptosis accompanied by DNA damage and activation of the ATM/Chk1/cdc25 pathway in human osteosarcoma cells.
17030618 2006 Timing and sequence requirements defined for embryonic maintenance of imprinted DNA methylation at Rasgrf1.
16969075 2006 H32, a non-quinone sulfone analog of vitamin K3, inhibits human hepatoma cell growth by inhibiting Cdc25 and activating ERK.
16855028 2006 RNA interference knockdown of hU2AF35 impairs cell cycle progression and modulates alternative splicing of Cdc25 transcripts.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14749369 2004 Activation of H-Ras in the endoplasmic reticulum by the RasGRF family guanine nucleotide exchange factors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622581 2003 The NMDA receptor is coupled to the ERK pathway by a direct interaction between NR2B and RasGRF1.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12095702 2002 Structural characterization of Rasgrf1 and a novel linked imprinted locus.
11877426 2002 Nerve growth factor-dependent activation of the small GTPase Rin.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11389730 2001 Differential actions of p60c-Src and Lck kinases on the Ras regulators p120-GAP and GDP/GTP exchange factor CDC25Mm.
10918068 2000 Characterization of RasGRP2, a plasma membrane-targeted, dual specificity Ras/Rap exchange factor.
10681520 2000 Induction of rac-guanine nucleotide exchange activity of Ras-GRF1/CDC25(Mm) following phosphorylation by the nonreceptor tyrosine kinase Src.
10373510 1999 Ras-specific exchange factor GRF: oligomerization through its Dbl homology domain and calcium-dependent activation of Raf.
10220378 1999 G protein beta gamma subunit-dependent Rac-guanine nucleotide exchange activity of Ras-GRF1/CDC25(Mm).
9384379 1997 A role for the Ras signalling pathway in synaptic transmission and long-term memory.
7828890 1994 Cloning and analysis of human cDNAs encoding a 140-kDa brain guanine nucleotide-exchange factor, Cdc25GEF, which regulates the function of Ras.
7684828 1993 Identification of a human guanine nucleotide-releasing factor (H-GRF55) specific for Ras proteins.
7637786 1995 Calcium activation of Ras mediated by neuronal exchange factor Ras-GRF.
1379731 1992 Identification of a mammalian gene structurally and functionally related to the CDC25 gene of Saccharomyces cerevisiae.