Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.21
PubTator Score 3.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -3.500 8.8e-07
astrocytic glioma -3.700 3.8e-03
Astrocytoma, Pilocytic -1.500 1.9e-02
atypical teratoid / rhabdoid tumor -4.200 1.8e-07
Breast cancer -1.800 2.5e-05
ependymoma -3.500 1.0e-02
gastric cancer 1.200 4.3e-04
glioblastoma -3.300 7.4e-07
group 3 medulloblastoma -3.500 2.9e-05
medulloblastoma, large-cell -6.200 4.7e-08
oligodendroglioma -3.000 9.4e-03
osteosarcoma -2.038 1.3e-02
ovarian cancer 1.700 1.6e-03
primitive neuroectodermal tumor -3.900 2.8e-05
Rheumatoid arthritis 1.200 2.7e-02
tuberculosis 1.600 3.7e-05

Gene RIF (1)

AA Sequence

MPQTSVVFSSILGPSCSGQVQPGMGERGGGAGGGSGDLIFQDGHLISGSLEALMEHLVPTVDYYPDRTYI      1 - 70
FTFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLLKEWTEAFPYDFQDEKAMAE     71 - 140
LKAITHRVTQCDEENGTVKKAIAQMTQSLLLSLAARSQLQELREKLRPPAVDKGPILKTKPPAAQKDILG    141 - 210
VCCDPLVLAQQLTHIELDRVSSIYPEDLMQIVSHMDSLDNHRCRGDLTKTYSLEAYDNWFNCLSMLVATE    211 - 280
VCRVVKKKHRTRMLEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVKTAKFDVLEHHMDPS    281 - 350
SNFCNYRTALQGATQRSQMANSSREKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEF    351 - 420
MTWTQVECPFEKDKKIQSYLLTAPIYSEEALFVASFESEGPENHMEKDSWKTLRTTLLNRA             421 - 481
//

Text Mined References (11)

PMID Year Title